DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Cxcr3

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_445867.1 Gene:Cxcr3 / 84475 RGDID:621528 Length:367 Species:Rattus norvegicus


Alignment Length:343 Identity:100/343 - (29%)
Similarity:174/343 - (50%) Gaps:56/343 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NNYAFTSEH-TDHSDHNANDSMEYDAE------SVALERIVSTIVPVFFGIIGFAGLLGNGLVIL 97
            ::.||..|: |...|:..|:|...|:.      |:..:|   |.:||.:.::...||||||.|..
  Rat    14 SDIAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR---TFLPVLYSLLFLLGLLGNGAVAA 75

  Fly    98 VVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSV 162
            |:::.:...|:|:..:::|||:|:|.|: .:|..|.| ...:|.||:..||....:..:..:...
  Rat    76 VLLSQRTALSSTDTFLLHLAVADVLLVL-TLPLWAVD-AAAQWVFGSGLCKVAGALFNINFYAGA 138

  Fly   163 YTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMC--AWITIVTTAIP----VALSHSVRIYQYH 221
            :.|..:||||:|::||  .:...|.:....:|:.|  .|...|..|:|    ::.||..|:    
  Rat   139 FLLACISFDRYLSIVH--ATQIYRRDPWVRVALTCIVVWGLCVLFALPDFIFLSASHDQRL---- 197

  Fly   222 GNAGTACVFSTEEEIWSLVG---FQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESR 283
             || |.|.::..:     ||   .:|...::.::.||.::.:.|..:||.|..|           
  Rat   198 -NA-THCQYNFPQ-----VGRTALRVLQLVAGFLMPLLVMAYCYAHILAVLLVS----------- 244

  Fly   284 KGKR--RVTRMVVVVVLAFAICWLPIHVILVLKAL--------NLYGGSHLSVIIQIISHVVAYT 338
            :|:|  |..|:|||||:|||:||.|.|:::::..|        |....||:.|...:.|. :.|.
  Rat   245 RGQRRFRAMRLVVVVVVAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKSVTSG-MGYM 308

  Fly   339 NSCINPILYAFLSDNFRK 356
            :.|:||:||||:...|::
  Rat   309 HCCLNPLLYAFVGVKFKE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 46/162 (28%)
7tm_1 91..347 CDD:278431 79/274 (29%)
Cxcr3NP_445867.1 7tm_1 73..317 CDD:278431 76/270 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.