DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and si:dkey-42l23.2

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_005173460.1 Gene:si:dkey-42l23.2 / 795679 ZFINID:ZDB-GENE-131121-582 Length:343 Species:Danio rerio


Alignment Length:313 Identity:88/313 - (28%)
Similarity:148/313 - (47%) Gaps:40/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTN-LLIINLAVSD 120
            |::|:  .|..|.|.....|..|.|.:    |::||.|||  .|...:|::|.| :..:|||::|
Zfish     9 NNTMQ--QELTATEIFNICITTVIFAV----GIIGNALVI--YVTGYKMKTTVNSIWFLNLAIAD 65

  Fly   121 ILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSL 185
            .:|::|.:....|......|.||:..||...::.|:....|::.|..:|.||.::....|.:.:.
Zfish    66 FIFILFLILTIFTLINKRVWYFGDFMCKLASFVSVLNMFASIFLLTAISLDRCMSTWWIVWAQNK 130

  Fly   186 RTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFFL-- 248
            ||.....:.....|:..:..:||..:..|........|.||...|......  :|||.:.|.:  
Zfish   131 RTLFKGRIICAFVWVLSICCSIPFVICRSGENKTCKYNPGTNINFLFTYRF--IVGFLIPFLVIA 193

  Fly   249 SSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVL 313
            |||:|         :|:.|:..|.....||           .|:::.|:|||.|||||.|:..::
Zfish   194 SSYIA---------IGVRAKRLKRGKKLKP-----------FRVILSVILAFFICWLPFHLQQLI 238

  Fly   314 KALNLYGGSHLSVIIQIISHV------VAYTNSCINPILYAFLSDNFRKAFRK 360
            .|:. .|....|.|.:::.::      :||.|||:|||||.|:.:.|:|..::
Zfish   239 TAMT-KGKDEWSGIRKVLYNIGPFVGSLAYFNSCLNPILYVFMCEEFKKKLKQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 39/157 (25%)
7tm_1 91..347 CDD:278431 74/264 (28%)
si:dkey-42l23.2XP_005173460.1 7tm_1 37..277 CDD:278431 74/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.