DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and SSTR5

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001044.1 Gene:SSTR5 / 6755 HGNCID:11334 Length:364 Species:Homo sapiens


Alignment Length:397 Identity:131/397 - (32%)
Similarity:198/397 - (49%) Gaps:76/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SW----PKASWGATGNGSIISVSNSSGNNYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIV 77
            ||    |.|:.|...|.:::..:.|:|                        |.:|        :|
Human    11 SWNASSPGAASGGGDNRTLVGPAPSAG------------------------ARAV--------LV 43

  Fly    78 PVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPF 142
            ||.:.::..|||.||.|||.||:...:|::.||:.|:||||:|:|::: .:||.||......|||
Human    44 PVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYML-GLPFLATQNAASFWPF 107

  Fly   143 GNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAI 207
            |.|.|:.|..:..|....||:.|.:||.||:||||||::|...|..|.|.||...||:..:..::
Human   108 GPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSL 172

  Fly   208 PVALSHSVRIYQYHGNAGTACVFSTEEEI--WSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLW 270
            |:.:...|:       .|..|..|..|.:  |..| |.:...:..:.|||.:||..|:.::.:: 
Human   173 PLLVFADVQ-------EGGTCNASWPEPVGLWGAV-FIIYTAVLGFFAPLLVICLCYLLIVVKV- 228

  Fly   271 KSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLP------IHVILVLKALNLYGGSHLSVIIQ 329
             .|.|.:.....|:.:|:|||||:||||.||.||||      :::.:.|.......|.:..|:| 
Human   229 -RAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVI- 291

  Fly   330 IISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC---GS-----------PPPLMTNQQVTKTT 380
                 ::|.|||.||:||.|||||||::|:||: |   ||           |..:...|:.|...
Human   292 -----LSYANSCANPVLYGFLSDNFRQSFQKVL-CLRKGSGAKDADATEPRPDRIRQQQEATPPA 350

  Fly   381 RTATGNG 387
            ..|..||
Human   351 HRAAANG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 60/158 (38%)
7tm_1 91..347 CDD:278431 94/263 (36%)
SSTR5NP_001044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/8 (38%)
7tm_4 54..319 CDD:304433 107/281 (38%)
7tm_1 57..304 CDD:278431 94/263 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..364 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.