DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and SSTR3

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001042.1 Gene:SSTR3 / 6753 HGNCID:11332 Length:418 Species:Homo sapiens


Alignment Length:341 Identity:108/341 - (31%)
Similarity:165/341 - (48%) Gaps:42/341 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TSEHTDHSDHNANDSMEYDA--------ESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVA 101
            :|..|.....||:.:...||        .|.|...:...::|:.:.::...|||||.|||.||:.
Human     7 SSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLLGNSLVIYVVLR 71

  Fly   102 NQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLV 166
            :....|.||:.|:|||::|.||:: .:||.|....|..||||::.|:.|..:..:....|::.|.
Human    72 HTASPSVTNVYILNLALADELFML-GLPFLAAQNALSYWPFGSLMCRLVMAVDGINQFTSIFCLT 135

  Fly   167 LMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFS 231
            :||.||:||||||..|...||...|.......|:......:||.:...|      ....:.|...
Human   136 VMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVVFSGV------PRGMSTCHMQ 194

  Fly   232 TEE--EIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLA-------RLWKSAPGCKPSAESRKGKR 287
            ..|  ..|. .||.:......:..||.:||..|:.::.       |:|  ||.|:   ..|:.:|
Human   195 WPEPAAAWR-AGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRVW--APSCQ---RRRRSER 253

  Fly   288 RVTRMVVVVVLAFAICWLPIHVILVLKAL------NLYGGSHLSVIIQIISHVVAYTNSCINPIL 346
            |||||||.||..|.:||:|.:|:.::..:      ..:.|.:..|:      .:.|.|||.||||
Human   254 RVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVV------ALPYANSCANPIL 312

  Fly   347 YAFLSDNFRKAFRKVV 362
            |.|||..|::.||:|:
Human   313 YGFLSYRFKQGFRRVL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 53/158 (34%)
7tm_1 91..347 CDD:278431 87/270 (32%)
SSTR3NP_001042.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/13 (31%)
7tm_4 55..>158 CDD:304433 45/103 (44%)
7tm_1 61..313 CDD:278431 87/270 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.