DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Cmklr1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_071554.2 Gene:Cmklr1 / 60669 RGDID:69359 Length:372 Species:Rattus norvegicus


Alignment Length:357 Identity:96/357 - (26%)
Similarity:165/357 - (46%) Gaps:88/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FTSEHTDHSDHNANDSMEYDAESVALE-RIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRS 107
            :..|::|.||:..:  :|   |:..|| ::....:.|.:.::.|.|:|||||||  |:|..:|:.
  Rat    12 YGEEYSDGSDYIVD--LE---EAGPLEAKVAEVFLVVIYSLVCFLGILGNGLVI--VIATFKMKK 69

  Fly   108 TTNLL-IINLAVSDILFVIFC---VPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLM 168
            |.|.: .:||||:|.||.||.   :.:.|.||   .|.||...||...:::....:.||:.|.::
  Rat    70 TVNTVWFVNLAVADFLFNIFLPIHITYAAMDY---HWVFGKAMCKISSFLLSHNMYTSVFLLTVI 131

  Fly   169 SFDRFLAVVHPVTSMSLRTERNATLAIMCAWI--------------TIVTT------------AI 207
            ||||.::|:.||.|.:.|:.|.|.:..:..|:              |:.|:            |.
  Rat   132 SFDRCISVLLPVWSQNHRSVRLAYMTCVVVWVLAFFLSSPSLVFRDTVSTSHGKITCFNNFSLAA 196

  Fly   208 PVALSHSVRI------YQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGML 266
            |...|||...      |..|                  |...|:.||..::.|:.:|...|:.::
  Rat   197 PEPFSHSTHPRTDPVGYSRH------------------VAVTVTRFLCGFLIPVFIITACYLTIV 243

  Fly   267 ARLWKSAPGCKPSAESRKGK-RRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQI 330
            .:|.:          :|..| ::..::::.:::.|.:||.|.|.:.:|:.      .|.:|...:
  Rat   244 FKLQR----------NRLAKTKKPFKIIITIIITFFLCWCPYHTLYLLEL------HHTAVPASV 292

  Fly   331 IS------HVVAYTNSCINPILYAFLSDNFRK 356
            .|      ..||..|||:|||||.|:..:|:|
  Rat   293 FSLGLPLATAVAIANSCMNPILYVFMGHDFKK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 55/192 (29%)
7tm_1 91..347 CDD:278431 79/298 (27%)
Cmklr1NP_071554.2 7tm_1 55..315 CDD:278431 79/298 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.