DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and RGR

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_002912.2 Gene:RGR / 5995 HGNCID:9990 Length:295 Species:Homo sapiens


Alignment Length:325 Identity:74/325 - (22%)
Similarity:132/325 - (40%) Gaps:61/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AESVALERIVSTIVPVFFG------------IIGFAGLLGNGLVILVVVANQQMRSTTNLLIINL 116
            ||:.||        |..||            :...:||..|.|.|.......::|:..:||:::|
Human     2 AETSAL--------PTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTPCHLLVLSL 58

  Fly   117 AVSDILFVIFCVPFTATDYVL----PEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVV 177
            |::|....:..: ..||..:|    ..||:|:..|:...:...||...|:.:...:::.|:    
Human    59 ALADSGISLNAL-VAATSSLLRVSHRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRY---- 118

  Fly   178 HPVTSMSLRTERNATLAIMCAWI-TIVTTAIP-VALSHSVRIYQYHGNAGTACV--FSTEEEIWS 238
            |...:.|.....:|...::..|: :....|:| :...|    |.|. ..||.|.  :|..:..::
Human   119 HHYCTRSQLAWNSAVSLVLFVWLSSAFWAALPLLGWGH----YDYE-PLGTCCTLDYSKGDRNFT 178

  Fly   239 LVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAIC 303
            ...|.:|||  ::..||.:....|..|..:|.||            |..:|...:....|...  
Human   179 SFLFTMSFF--NFAMPLFITITSYSLMEQKLGKS------------GHLQVNTTLPARTLLLG-- 227

  Fly   304 WLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVW-CGSP 367
            |.| :.||.|.|: :...:.:|..:|::..::|.....||.|.||..::...:.    :| |.||
Human   228 WGP-YAILYLYAV-IADVTSISPKLQMVPALIAKMVPTINAINYALGNEMVCRG----IWQCLSP 286

  Fly   368  367
            Human   287  286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 35/164 (21%)
7tm_1 91..347 CDD:278431 59/263 (22%)
RGRNP_002912.2 7tmA_Retinal_GPR 17..281 CDD:320200 63/295 (21%)
TM helix 1 18..44 CDD:320200 5/25 (20%)
TM helix 2 51..77 CDD:320200 7/26 (27%)
TM helix 3 92..122 CDD:320200 6/33 (18%)
TM helix 4 130..150 CDD:320200 3/19 (16%)
TM helix 5 177..206 CDD:320200 8/30 (27%)
TM helix 6 208..238 CDD:320200 10/44 (23%)
TM helix 7 248..273 CDD:320200 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.