DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Cysltr1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001268788.1 Gene:Cysltr1 / 58861 MGIID:1926218 Length:352 Species:Mus musculus


Alignment Length:351 Identity:93/351 - (26%)
Similarity:163/351 - (46%) Gaps:59/351 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VSNSSGNNYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILV 98
            :.|.:|.. ..|:...:::.|:..|...        .::.||:    :.:|...|..||..|:.|
Mouse    11 LENMNGTE-NLTTSLINNTCHDTIDEFR--------NQVYSTM----YSVISVVGFFGNSFVLYV 62

  Fly    99 VVANQQMRSTTNLLIINLAVSDILFVIFC-VPFTATDYV-LPEWPFGNVWCKFVQYMIVVTCHCS 161
            ::.....:|...:.:||||::|:|.|  | :|.....|| ..:|.||:..|:...|.:.|..:||
Mouse    63 LIKTYHEKSAFQVYMINLAIADLLCV--CTLPLRVVYYVHKGKWLFGDFLCRLTTYALYVNLYCS 125

  Fly   162 VYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGT 226
            ::.:..|||.|.:|:|.||.:::|.|::.|....:..||.::.|:.|..:..|   ||...| .|
Mouse   126 IFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSPFLMYKS---YQDEKN-NT 186

  Fly   227 ACV---FSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRR 288
            .|.   .:.:.:.:.|:...||.|. .::.|...|...|..::..|.|:.  .|.:..||   |:
Mouse   187 KCFEPPQNNQAKKYVLILHYVSLFF-GFIIPFVTIIVCYTMIILTLLKNT--MKKNMPSR---RK 245

  Fly   289 VTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHL----------------SVIIQIISHVVAY 337
            ...|::||..||.:.::|.|   :.:.::|    ||                ||:|.:   .:|.
Mouse   246 AIGMIIVVTAAFLVSFMPYH---IQRTIHL----HLLHSETRPCDSVLRMQKSVVITL---SLAA 300

  Fly   338 TNSCINPILYAFLSDNFRK---AFRK 360
            :|.|.:|:||.|...|||:   .|||
Mouse   301 SNCCFDPLLYFFSGGNFRRRLSTFRK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 47/161 (29%)
7tm_1 91..347 CDD:278431 75/276 (27%)
Cysltr1NP_001268788.1 7tm_4 47..264 CDD:304433 65/228 (29%)
7tm_1 55..310 CDD:278431 75/276 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.