DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Rgr

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_067315.1 Gene:Rgr / 57811 MGIID:1929473 Length:291 Species:Mus musculus


Alignment Length:314 Identity:72/314 - (22%)
Similarity:119/314 - (37%) Gaps:70/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 AGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQ 151
            :|:..|||.|........:|:.:|||:::||::|....:..: ..|...:|..||.|:..|:...
Mouse    29 SGISLNGLTIFSFCKTPDLRTPSNLLVLSLALADTGISLNAL-VAAVSSLLRRWPHGSEGCQVHG 92

  Fly   152 YMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVAL----- 211
            :....|...|:.....:::.|:   .|..|...|            ||    .||||:.|     
Mouse    93 FQGFATALASICGSAAVAWGRY---HHYCTRRQL------------AW----DTAIPLVLFVWMS 138

  Fly   212 ------------SHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMG 264
                        .|    |.|. ..||.|.........:.:.|..:....:::.||.:....|..
Mouse   139 SAFWASLPLMGWGH----YDYE-PVGTCCTLDYSRGDRNFISFLFTMAFFNFLVPLFITHTSYRF 198

  Fly   265 MLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQ 329
            |..:..:|  |..|...:..|     ||::       :.|.| :.:|.|.|. :...|.:|..:|
Mouse   199 MEQKFSRS--GHLPVNTTLPG-----RMLL-------LGWGP-YALLYLYAA-IADVSFISPKLQ 247

  Fly   330 IISHVVAYTNSCINPILYAFLSDNFRKAFRKVVW-CGSPPPLMTNQQVTKTTRT 382
            ::..::|.|...||.|.||.    .|:...:..| |.||       |.:|..||
Mouse   248 MVPALIAKTMPTINAINYAL----HREMVCRGTWQCLSP-------QKSKKDRT 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 37/169 (22%)
7tm_1 91..347 CDD:278431 60/272 (22%)
RgrNP_067315.1 Csx17_I-U <38..>139 CDD:276221 27/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.