DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and ACKR3

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_064707.1 Gene:ACKR3 / 57007 HGNCID:23692 Length:362 Species:Homo sapiens


Alignment Length:350 Identity:86/350 - (24%)
Similarity:160/350 - (45%) Gaps:65/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SEHTDHSD----HNANDSMEYDA--------ESVALERIVSTIVPVFFGIIGFAGLLGNGLVILV 98
            ||..:.||    .|::|.:..|.        :||.|..:  :.:.:|..:|   |::.|.:|:.|
Human     9 SEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTL--SFIYIFIFVI---GMIANSVVVWV 68

  Fly    99 VVANQQMRST---TNLLIINLAVSDILFVIFCVPFTATDYVL-PEWPFGNVWCKFVQYMIVVTCH 159
               |.|.::|   |:..|:|||::| |:|:..:|......|. .:||.|.:.||....:..:...
Human    69 ---NIQAKTTGYDTHCYILNLAIAD-LWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLF 129

  Fly   160 CSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNA 224
            .|::.|..||.||:|::.:...:.|.|.:....:..:..|:.....::|.  ::.::......|.
Human   130 GSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPD--TYYLKTVTSASNN 192

  Fly   225 GTAC-VFSTEEEI--WSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGK 286
            .|.| .|..|..|  | |:|.::...:..:..|.::|...|. :|||        ..||.|.:.|
Human   193 ETYCRSFYPEHSIKEW-LIGMELVSVVLGFAVPFSIIAVFYF-LLAR--------AISASSDQEK 247

  Fly   287 RRVTRMVVVVVLAFAICWLPIHVILVLKALN--------------LYGGSHLSVIIQIISHVVAY 337
            ....:::...|:.|.:||||.||.::|...:              |:...|::..:.::      
Human   248 HSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLV------ 306

  Fly   338 TNSCINPILYAFLSDNFR----KAF 358
             :.|:||:||:|::.|:|    |||
Human   307 -HCCVNPVLYSFINRNYRYELMKAF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 41/163 (25%)
7tm_1 91..347 CDD:278431 65/276 (24%)
ACKR3NP_064707.1 7tm_1 62..315 CDD:278431 65/275 (24%)
C-terminal cytoplasmic tail 324..362 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.