DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and ccr7

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001092213.1 Gene:ccr7 / 565958 ZFINID:ZDB-GENE-060522-2 Length:372 Species:Danio rerio


Alignment Length:346 Identity:72/346 - (20%)
Similarity:151/346 - (43%) Gaps:30/346 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KASWGATGNGSIISVSNSSGNNYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGII 84
            |.||   .|.:...:...:...|.:|:...|:      |..|............:..:|..:.||
Zfish    19 KKSW---SNMTEHQMGEKATTEYDYTTGTVDY------DIYEQSCNKTNNRTFRAWFLPTIYTII 74

  Fly    85 GFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKF 149
            ....|:||.||||..:..:::::.|::.:.|||::|:||.| .:||.|..: :..|..|...||.
Zfish    75 CLLALMGNFLVILTYLYFKRLKTMTDVYLFNLAMADLLFAI-SLPFWAASF-MSTWHLGLYPCKA 137

  Fly   150 VQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWI-TIVTTAIPVALSH 213
            :..:..|:....::.|..:|.||:.::...|::...|:.     |:....: ::||..|.:..|.
Zfish   138 MFTIYKVSFFSGMFLLTCISIDRYFSITKAVSAHRCRSS-----AVYYGQVSSLVTWVIAIVFSV 197

  Fly   214 SVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKP 278
            ...::....:.||.......::.:  |...:|..:..::.|..::.|.|:.::..|.::      
Zfish   198 PDMVFAVINSRGTCSANVNYQDYY--VKMVISQMVLGFIIPAVVMGFCYICIIKTLMQA------ 254

  Fly   279 SAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNL--YGGSHLSVIIQIISHVVAYTNSC 341
               ....:.:..::::.||:.|....||.:|::.:.....  ....:..:....::..||:...|
Zfish   255 ---KNFERNKAFKVIIAVVVVFVFSQLPYNVVMGVSVQQTTDCAKDNTRLFALDVTMAVAFLRCC 316

  Fly   342 INPILYAFLSDNFRKAFRKVV 362
            :||.||||:...||....|::
Zfish   317 VNPFLYAFIGVKFRNDLLKLL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 38/157 (24%)
7tm_1 91..347 CDD:278431 52/258 (20%)
ccr7NP_001092213.1 7tm_1 81..322 CDD:278431 52/258 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.