DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and ackr3b

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001077301.1 Gene:ackr3b / 561050 ZFINID:ZDB-GENE-031116-61 Length:362 Species:Danio rerio


Alignment Length:313 Identity:91/313 - (29%)
Similarity:145/313 - (46%) Gaps:59/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYV-LP 138
            :::.:|..|||.|   .|.||:.|.|..::.|..|:|.|:|||::| |.|:..:|.:.:..: |.
Zfish    47 SVLYIFLFIIGLA---ANALVVWVNVRAERTRYETHLYILNLAIAD-LCVVATLPVSISSLLQLG 107

  Fly   139 EWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIV 203
            .||||...||....:..|....|::.|..||.||:|:|.....:.|.|..|...:..:..|:..:
Zfish   108 HWPFGGAMCKITHLIFSVNLFSSIFFLTCMSVDRYLSVKLFGDTPSQRKRRTRQIICVGVWLLAL 172

  Fly   204 TTAIPVALSHSVRIY------QYHGNAGTAC--VFSTEE-EIWSLVGFQVSFFLSSYVAPLTLIC 259
            ..|:|       .||      ..|.:| ..|  |:..|. :.|: ||.|:|||:..:..|..:|.
Zfish   173 IAALP-------EIYFLQAEKSDHSDA-IVCKAVYPVESMKEWT-VGIQMSFFMLGFAIPFPVIA 228

  Fly   260 FLYMGMLARLWKSAPGCKPSAESRKGKRRVTR-MVVVVVLAFAICWLPIHVILVLKAL------- 316
            ..|: :||..      ..||.:.   :||::| ::...::.|.:||||.|..|:|..|       
Zfish   229 VFYV-LLANT------IHPSVDQ---ERRISRHLIFTYIVVFLVCWLPYHGALLLDTLAFLNVLP 283

  Fly   317 -------NLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFR----KAF 358
                   .||...||:....:.       :.|.|||:|.|::.|:|    |||
Zfish   284 FNCTLENALYAALHLTQCFSLF-------HCCANPIIYNFINKNYRYDLMKAF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 50/166 (30%)
7tm_1 91..347 CDD:278431 79/280 (28%)
ackr3bNP_001077301.1 7tm_1 61..314 CDD:278431 79/279 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.