DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and rgra

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001017877.1 Gene:rgra / 550575 ZFINID:ZDB-GENE-040924-6 Length:295 Species:Danio rerio


Alignment Length:308 Identity:58/308 - (18%)
Similarity:126/308 - (40%) Gaps:68/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GLLG---NGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKF 149
            ||||   |.:.::..:..:::|:.:|.|:.:||::| :.:.......|....|..||:|:..|:.
Zfish    27 GLLGFFLNAVTVIAFLKIRELRTPSNFLVFSLAMAD-MGISTNATVAAFSSFLRYWPYGSDGCQT 90

  Fly   150 VQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWI-TIVTTAIPV---- 209
            ..:...:|...|::.:..:::||:    |...:.:.....:|...::..|: |....|:|:    
Zfish    91 HGFQGFMTALASIHFIAAIAWDRY----HQYCTRTKLQWSSAITLVLFTWLFTAFWAAMPLFGWG 151

  Fly   210 -----------ALSHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYM 263
                       .|.:|.....|........:|:        :|.||...||||.:          
Zfish   152 EYDYEPLRTCCTLDYSKGDRNYVSYLIPMSIFN--------MGIQVFVVLSSYQS---------- 198

  Fly   264 GMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVII 328
              :.:.:|           :.|:.:......:..:.|  ||.|..::....|:.  ..:.:|..:
Zfish   199 --IDKKFK-----------KTGQAKFNCGTPLKTMLF--CWGPYGILAFYAAVE--NATLVSPKL 246

  Fly   329 QIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSPPPLMTNQQV 376
            ::|:.::|.|:...|..:||..::|:|..    :|     .|:|.|::
Zfish   247 RMIAPILAKTSPTFNVFVYALGNENYRGG----IW-----QLLTGQKI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 31/170 (18%)
7tm_1 91..347 CDD:278431 47/274 (17%)
rgraNP_001017877.1 7tm_1 34..265 CDD:278431 46/270 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.