DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Galr1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_037090.2 Gene:Galr1 / 50577 RGDID:2656 Length:346 Species:Rattus norvegicus


Alignment Length:327 Identity:124/327 - (37%)
Similarity:184/327 - (56%) Gaps:31/327 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SDHNANDSMEYDAE-----SVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQ--QMRSTT 109
            |:.|.:|. |..||     .:.:|..::.:|   ||:|...|:|||.|||.|:..::  :.||||
  Rat     9 SEGNGSDP-EPPAEPRPLFGIGVENFITLVV---FGLIFAMGVLGNSLVITVLARSKPGKPRSTT 69

  Fly   110 NLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFL 174
            ||.|:||:::|:.:::||:||.||.|.||.|..|...|||:.|...|:...|::||..||.||::
  Rat    70 NLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYV 134

  Fly   175 AVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQ--YHGNAG-TACVFSTEEEI 236
            |:||...|.|||..|||.|.:...|      |:.:|::..|..||  :|.::. |.|     .|.
  Rat   135 AIVHSRRSSSLRVSRNALLGVGFIW------ALSIAMASPVAYYQRLFHRDSNQTFC-----WEH 188

  Fly   237 W----SLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVV 297
            |    ....:.|..|:..|:.||.||||.|..:|..|.|.....  |.:|...|::..:.|:|||
  Rat   189 WPNQLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNM--SKKSEASKKKTAQTVLVVV 251

  Fly   298 LAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVV 362
            :.|.|.|||.|||.:......:..:..|...:|.:|.:||:||.:|||:|||||:|||||:::|.
  Rat   252 VVFGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVF 316

  Fly   363 WC 364
            .|
  Rat   317 KC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 64/165 (39%)
7tm_1 91..347 CDD:278431 99/264 (38%)
Galr1NP_037090.2 7tm_1 49..301 CDD:278431 99/264 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 179 1.000 Domainoid score I3436
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3578
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 1 1.000 - - FOG0000972
OrthoInspector 1 1.000 - - mtm9131
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1132
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.