DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and OPRM1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001138751.1 Gene:OPRM1 / 4988 HGNCID:8156 Length:493 Species:Homo sapiens


Alignment Length:359 Identity:117/359 - (32%)
Similarity:189/359 - (52%) Gaps:18/359 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ATGNGSIISVSNSSGNNYAFTSE--HTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFA 87
            |...||.:::|:..||    .|:  ..:.:|....||:.....|.::  |.:..:...:.|:...
Human   118 APSPGSWVNLSHLDGN----LSDPCGPNRTDLGGRDSLCPPTGSPSM--ITAITIMALYSIVCVV 176

  Fly    88 GLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQY 152
            ||.||.||:.|:|...:|::.||:.|.|||::|.| ....:||.:.:|::..||||.:.||.|..
Human   177 GLFGNFLVMYVIVRYTKMKTATNIYIFNLALADAL-ATSTLPFQSVNYLMGTWPFGTILCKIVIS 240

  Fly   153 MIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRI 217
            :.......|::||..||.||::||.|||.::..||.|||.:..:|.||......:||....:.:.
Human   241 IDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKY 305

  Fly   218 YQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAES 282
            .|  |:......||.....|..: .::..|:.:::.|:.:|...|..|:.|| ||......|.|.
Human   306 RQ--GSIDCTLTFSHPTWYWENL-LKICVFIFAFIMPVLIITVCYGLMILRL-KSVRMLSGSKEK 366

  Fly   283 RKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILY 347
            .:..||:||||:|||..|.:||.|||:.:::|||.....:....:.......:.|||||:||:||
Human   367 DRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLY 431

  Fly   348 AFLSDNFRKAFRKVVWCGSPPPLMTNQQVTKTTR 381
            |||.:||::.||:  :|   .|..:|.:...:||
Human   432 AFLDENFKRCFRE--FC---IPTSSNIEQQNSTR 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 55/156 (35%)
7tm_1 91..347 CDD:278431 88/255 (35%)
OPRM1NP_001138751.1 7tm_4 172..>376 CDD:304433 69/208 (33%)
7tm_1 180..431 CDD:278431 88/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.