DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and OPRD1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_000902.3 Gene:OPRD1 / 4985 HGNCID:8153 Length:372 Species:Homo sapiens


Alignment Length:394 Identity:120/394 - (30%)
Similarity:186/394 - (47%) Gaps:60/394 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGHQSLALLLATLISSWPKA--SWGATGNGSIISVSNSSGNNYAFTSEHTDHSDHNANDSMEYDA 64
            ||.:....|.|....::|.|  |.||..:|...:.|.||                        .|
Human     7 AGAELQPPLFANASDAYPSACPSAGANASGPPGARSASS------------------------LA 47

  Fly    65 ESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVP 129
            .::|:..:.|.:..|        |||||.||:..:|...:|::.||:.|.|||::|.| ....:|
Human    48 LAIAITALYSAVCAV--------GLLGNVLVMFGIVRYTKMKTATNIYIFNLALADAL-ATSTLP 103

  Fly   130 FTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLA 194
            |.:..|::..||||.:.||.|..:.......|::||.:||.||::||.|||.::..||...|.|.
Human   104 FQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLI 168

  Fly   195 IMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACV--FSTEEEIWSLVGFQVSFFLSSYVAPLTL 257
            .:|.|:......:|:.:....|    ..:....|:  |.:....|..| .::..||.::|.|:.:
Human   169 NICIWVLASGVGVPIMVMAVTR----PRDGAVVCMLQFPSPSWYWDTV-TKICVFLFAFVVPILI 228

  Fly   258 ICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKAL------ 316
            |...|..||.|| :|......|.|..:..||:||||:|||.||.:||.|||:.:::..|      
Human   229 ITVCYGLMLLRL-RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRR 292

  Fly   317 --NLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVW--CGSPPPLMTNQQVT 377
              .:....||.:       .:.|.||.:||:|||||.:||::.||::..  ||.|.|...::...
Human   293 DPLVVAALHLCI-------ALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRARE 350

  Fly   378 KTTR 381
            .|.|
Human   351 ATAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 50/158 (32%)
7tm_1 91..347 CDD:278431 85/265 (32%)
OPRD1NP_000902.3 7tm_4 59..>232 CDD:304433 57/186 (31%)
7tm_1 66..318 CDD:278431 85/265 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..372 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.