DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and sstr5

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_998462.1 Gene:sstr5 / 406588 ZFINID:ZDB-GENE-040426-2502 Length:383 Species:Danio rerio


Alignment Length:318 Identity:100/318 - (31%)
Similarity:173/318 - (54%) Gaps:14/318 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLL 112
            :|..|:...|.|::.:...:|.|.....:..::. ::...||.||.|.|.||:...:|::.||:.
Zfish     9 NTSLSNQTTNSSIDPNENLLAEEESTKALAVIYL-VVFIVGLTGNSLAIFVVLRYTKMKTVTNMY 72

  Fly   113 IINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVV 177
            |:||||:|.|::: .:||..|..||..|||||..|:.:.:...::...|.:.|.:||.||::|||
Zfish    73 ILNLAVADELYIL-GLPFLTTHNVLSYWPFGNFLCRILMWADSISQFTSTFCLTVMSIDRYMAVV 136

  Fly   178 HPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAG-TACVFSTEE--EIWSL 239
            ||:.|...|....|.:.....|.......:||.:...|:       .| ..|..|..|  ::|| 
Zfish   137 HPIRSARWRRPSVAKVINSMVWALSCLLTLPVIIYCDVQ-------PGLNTCNLSWPEPRDVWS- 193

  Fly   240 VGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICW 304
            ..|.:...:..:..||.:||..|:.::.:: |||......::.||.:::||||||::|:.|.|||
Zfish   194 TAFILYTAILGFFCPLLVICLCYLLIVIKV-KSASARAGLSKRRKSEKKVTRMVVIIVVVFVICW 257

  Fly   305 LPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVV 362
            ||..::.:...:.....:::...:..::.::.|.|||.||:||.||||||:::|:||:
Zfish   258 LPFFMLNIFNLVVTLPENNIITGVYFLTVILTYVNSCANPLLYGFLSDNFKRSFQKVL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 53/159 (33%)
7tm_1 91..347 CDD:278431 81/258 (31%)
sstr5NP_998462.1 7tm_4 42..>241 CDD:304433 64/209 (31%)
7tm_1 51..300 CDD:278431 81/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.