DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and oprd1b

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_997920.2 Gene:oprd1b / 336529 ZFINID:ZDB-GENE-030131-8473 Length:375 Species:Danio rerio


Alignment Length:343 Identity:111/343 - (32%)
Similarity:177/343 - (51%) Gaps:25/343 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ISVSNSSG------NNYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLL 90
            ::||:.|.      :|.:|..|......:.:..|.|..|...:....::..:...:.:|...||:
Zfish     6 VTVSDFSERYPLFLHNSSFLEEPAGLLSNWSGGSSELKAVRGSSAVAIAVSITALYSVICVVGLV 70

  Fly    91 GNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIV 155
            ||.||:..||...:|::.||:.|.|||::|.| ....:||.:..|::..||||.:.||.|..:..
Zfish    71 GNVLVMYGVVRYTKMKTATNIYIFNLALADAL-ATSTLPFQSAKYLMGTWPFGELLCKVVIAIDY 134

  Fly   156 VTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQY 220
            .....|::||.:||.||::||.|||.::..||...|.:..:|.||.......||.:   :.:.:.
Zfish   135 YNMFTSIFTLTMMSVDRYIAVCHPVRALDFRTPVKAKIINICVWILSSAVGFPVMV---MAVTKE 196

  Fly   221 HGNAGTACV--FSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESR 283
            ..:..|.|:  |...|..|..| .::..|:.::|.|:.:|...|..|:.|| ||......|.|..
Zfish   197 LDSGKTICMLKFPDPEWYWDTV-TKICVFIFAFVFPVLVITVCYGLMILRL-KSVRLLSGSKEKD 259

  Fly   284 KGKRRVTRMVVVVVLAFAICWLPIHVILVLKAL------NLYGGSHLSVIIQIISHVVAYTNSCI 342
            :..||:||||:|||.||.|||.|||:.:::|.:      ||     |.|....:...:.|.||.:
Zfish   260 RNLRRITRMVLVVVAAFIICWTPIHIFIIVKTVVEIDQKNL-----LVVACWHLCIALGYMNSSL 319

  Fly   343 NPILYAFLSDNFRKAFRK 360
            ||:|||||.:||::.||:
Zfish   320 NPVLYAFLDENFKRCFRE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 53/158 (34%)
7tm_1 91..347 CDD:278431 90/263 (34%)
oprd1bNP_997920.2 7tm_1 76..324 CDD:278431 86/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.