DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and HCRTR2

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_016866287.1 Gene:HCRTR2 / 3062 HGNCID:4849 Length:461 Species:Homo sapiens


Alignment Length:324 Identity:98/324 - (30%)
Similarity:155/324 - (47%) Gaps:47/324 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWC 147
            |:....|:||.||.:.|..|..||:.||..|:||:::|:|..|.|:|.|....:...|.||...|
Human    63 IVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLC 127

  Fly   148 KFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALS 212
            |.:.|:..|:...||.||..::.||:.|:.||:  |...|.:.|..:|:..||......||.|:.
Human   128 KVIPYLQTVSVSVSVLTLSCIALDRWYAICHPL--MFKSTAKRARNSIVIIWIVSCIIMIPQAIV 190

  Fly   213 HSVRIYQYHGNAGTACVFSTEEEIWSLVG------FQVSFFLSSYVAPLTLICFLYMGMLARLW- 270
            ...... :.|.|....:|:..:|.|.  |      :.:.|||.:|:|||.|:...|:.:..:|| 
Human   191 MECSTV-FPGLANKTTLFTVCDERWG--GEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWC 252

  Fly   271 KSAPG-----------CKPSAESR--------------------KGKRRVTRMVVVVVLAFAICW 304
            :..||           .:|.::.|                    :.:|:..||:::|:|.||||:
Human   253 RQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRKTARMLMIVLLVFAICY 317

  Fly   305 LPIHVILVLK-ALNLYGGSHLSVIIQ---IISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364
            |||.::.||| ...::..:.....:.   ..||.:.|.||..|||:|.|||..||:.|:....|
Human   318 LPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSC 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 51/156 (33%)
7tm_1 91..347 CDD:278431 88/297 (30%)
HCRTR2XP_016866287.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.