DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and oprd1a

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_571333.2 Gene:oprd1a / 30509 ZFINID:ZDB-GENE-990415-199 Length:374 Species:Danio rerio


Alignment Length:323 Identity:109/323 - (33%)
Similarity:169/323 - (52%) Gaps:26/323 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYV 136
            |::..:...:.:|...|||||.||:..||...::::.||:.|.|||::|.| ....:||.:|.|:
Zfish    51 IIAISITALYSVICVVGLLGNILVMYGVVRYTKLKTATNIYIFNLALADAL-ATSTLPFQSTKYL 114

  Fly   137 LPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWIT 201
            :..||||.:.||.|..:.......|::||.:||.||::||.|||.::..||...|.:..:|.||.
Zfish   115 MNTWPFGELLCKVVIAIDYYNMFTSIFTLTMMSVDRYIAVCHPVRALEFRTPIKAKIINVCIWIL 179

  Fly   202 IVTTAIPVALSHSVRIYQYHGNAGTACV--FSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMG 264
            .....:|:.:....|:...:   .|.|:  |...:..|..| .::..|:.::|.|:.:|...|..
Zfish   180 SSAVGVPIMIMAVTRVTNQN---TTVCMLKFPDPDWYWDTV-TKICVFIFAFVVPVLVITICYGL 240

  Fly   265 MLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKAL--------NLYGG 321
            |:.|| ||......|.|..:..||:||||:|||.||.|||.|||:.:::|.|        .:...
Zfish   241 MILRL-KSVRLLSGSKEKDRNMRRITRMVLVVVAAFIICWTPIHIFIIVKTLVDINQKNPFVIAS 304

  Fly   322 SHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSPPPLMTNQQVTKTTRTAT 384
            .||.:       .:.||||.:||:|||||.:||::.||.  :| .|.....:|......|.||
Zfish   305 WHLCI-------ALGYTNSSLNPVLYAFLDENFKRCFRD--FC-LPFRTRADQSNLNRARNAT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 53/158 (34%)
7tm_1 91..347 CDD:278431 89/265 (34%)
oprd1aNP_571333.2 7tm_4 62..>269 CDD:304433 71/212 (33%)
7tm_1 70..323 CDD:278431 89/265 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.