DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Npbwr1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001014784.1 Gene:Npbwr1 / 297795 RGDID:1305917 Length:329 Species:Rattus norvegicus


Alignment Length:314 Identity:97/314 - (30%)
Similarity:156/314 - (49%) Gaps:23/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVI 125
            |.:...:.|.:.::..|||.:|:|...||.||..|:.|::...:|::.||:.|:|||::|.||.:
  Rat    26 ESNPAPLPLPQPLAVAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTL 90

  Fly   126 FCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTS--MSLRTE 188
             .:|....|::|..||||.|.||.:..:.......|:|.|.:||.||:|.|:....|  :|.||.
  Rat    91 -VLPINIADFLLRRWPFGEVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTY 154

  Fly   189 RNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIW--------SLVGFQVS 245
            ..|....:..|..:....:|.|:  ..|:.:..|......||...|..|        .::||.: 
  Rat   155 GAARAVSLAVWALVTLVVLPFAV--FARLDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAI- 216

  Fly   246 FFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVI 310
                    |::.||.||:.:|.||..........|..| .|:|||.:||.::....:||.|.|:.
  Rat   217 --------PVSTICALYITLLCRLRAIQLDSHAKALDR-AKKRVTLLVVAILAVCLLCWTPYHLS 272

  Fly   311 LVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364
            .::........:.|.:.|......::|.|||:||.|||||.|:||::.|::|.|
  Rat   273 TIVALTTDLPQTPLVIGISYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLVSC 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 50/166 (30%)
7tm_1 91..347 CDD:278431 77/265 (29%)
Npbwr1NP_001014784.1 7tm_1 56..309 CDD:278431 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.