DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Ffar4

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001040553.1 Gene:Ffar4 / 294075 RGDID:1308252 Length:361 Species:Rattus norvegicus


Alignment Length:314 Identity:77/314 - (24%)
Similarity:134/314 - (42%) Gaps:36/314 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYV 136
            ::|.:.....|:|....|||| :..||:|..::.|..|..|::||..:|:||. ..:|.......
  Rat    38 VLSVLETTVLGLIFVVSLLGN-VCALVLVVRRRRRGATVSLVLNLFCADLLFT-SAIPLVLVVRW 100

  Fly   137 LPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWIT 201
            ...|..|.|.|..:.|::.::...::.||..:|.:|.:.:|.....:|....|.....:...|..
  Rat   101 TEAWLLGPVVCHLLFYVMTMSGSVTILTLAAVSLERMVCIVRLRRGLSGPGRRTQAALLAFIWGY 165

  Fly   202 IVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEI------W----SLVGFQVSFFLSSYVAPLT 256
            ....|:|:.:...|...:..|.         ::||      |    ..:.:.|.|...:::.|..
  Rat   166 SALAALPLCILFRVVPQRLPGG---------DQEIPICTLDWPNRIGEISWDVFFVTLNFLVPGL 221

  Fly   257 LICFLYMGML-------ARLWKSAPGCKPSAESRKGKR--RVTRMVVVVVLAFAICWLPIHVILV 312
            :|...|..:|       .||..|. ....|.:.|..::  |:.|.:.:::::|.|.|.|| :|.:
  Rat   222 VIVISYSKILQITKASRKRLTLSL-AYSESHQIRVSQQDYRLFRTLFLLMVSFFIMWSPI-IITI 284

  Fly   313 LKALNLYGGSHLSVIIQIISHVVAYT--NSCINPILYAFLSDNFRKAFRKVVWC 364
            |..|.......|.:...:...|||:|  ||.:|||||..  ..||..:||:..|
  Rat   285 LLILIQNFRQDLVIWPSLFFWVVAFTFANSALNPILYNM--SLFRSEWRKIFCC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 37/166 (22%)
7tm_1 91..347 CDD:278431 65/276 (24%)
Ffar4NP_001040553.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
7tm_1 77..321 CDD:278431 58/255 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.