DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Oprl1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001305876.1 Gene:Oprl1 / 29256 RGDID:68438 Length:396 Species:Rattus norvegicus


Alignment Length:320 Identity:112/320 - (35%)
Similarity:167/320 - (52%) Gaps:33/320 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TIVPVFFGI-IGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLP 138
            |||.::..: ||  |||||.||:.|::.:.:|::.||:.|.|||::|.| |:..:||..||.:|.
  Rat    50 TIVGLYLAVCIG--GLLGNCLVMYVILRHTKMKTATNIYIFNLALADTL-VLLTLPFQGTDILLG 111

  Fly   139 EWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIV 203
            .|||||..||.|..:.......|.:||..||.||::|:.||:.::.:||...|....:..|....
  Rat   112 FWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALAS 176

  Fly   204 TTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVG-----------FQVSFFLSSYVAPLTL 257
            ...:|||:..|.::              .:|||..||.           |.:..||.|::.|:.:
  Rat   177 VVGVPVAIMGSAQV--------------EDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLI 227

  Fly   258 ICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGS 322
            |...|..|:.|| :.......|.|..:..||:||:|:|||..|..||.|:.|.::::.|.:..||
  Rat   228 ISVCYSLMIRRL-RGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGS 291

  Fly   323 HLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSPPPLMTNQQVTKTTRT 382
            ..:|.|......:.|.|||:||||||||.:||:..|||.. |.|  .|....||:...|:
  Rat   292 ETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFC-CAS--SLHREMQVSDRVRS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 54/157 (34%)
7tm_1 91..347 CDD:278431 88/266 (33%)
Oprl1NP_001305876.1 7tm_4 63..>185 CDD:304433 47/122 (39%)
7tm_1 65..316 CDD:278431 88/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.