DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Olr896

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001000059.1 Gene:Olr896 / 288813 RGDID:1334017 Length:316 Species:Rattus norvegicus


Alignment Length:318 Identity:66/318 - (20%)
Similarity:141/318 - (44%) Gaps:48/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVP-FTATDYV 136
            :..::.||..|.....:.||..:|::.:.:.|:::.....:.|.::.:..|...|:| |.||  :
  Rat    21 LQVLIFVFIFITYILSITGNLTIIILTLLDSQLQTPMYFFLRNFSILEASFTTVCIPRFLAT--I 83

  Fly   137 LPE---WPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCA 198
            :.|   ..|.|  |....:.:::......|.|..||:||::|:..|:..:::.:::..|:.:...
  Rat    84 ISEDKTISFNN--CIAQLFFLILFGITEFYLLAAMSYDRYIAICKPLHYLTIMSQKVCTMLVFAC 146

  Fly   199 WIT---IVTTAIPVAL------SHSVRIY--QYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYV 252
            |:.   |:..|:.:.|      |:.:..|  .|......:|   :..:....:||..:.|...:.
  Rat   147 WLVSFLIIFPALMLLLQLDYCGSNIIDHYTCDYFPLLQLSC---SNTKFLERIGFSCAVFTLMFT 208

  Fly   253 APLTLICFLYMGMLARLWKSAPGCKPSAESR-KGKRRVTRMVVVVVLAFAICWLPIHVILVLKAL 316
              |.||...|:.::..:.|.     |||..| |.....:..::|:.:::..|     :.:.:|. 
  Rat   209 --LVLIILSYICIIRTIVKI-----PSASQRSKAFSTCSSHMIVISISYGSC-----IFMYIKP- 260

  Fly   317 NLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAF----RKVVW-----CG 365
            :....:.|:..:.|::..||   ..:||.:|:..:...:|||    ||:|:     ||
  Rat   261 SAADRASLTKGVAILNTSVA---PMLNPFIYSLRNQQVKKAFLNIARKMVFFTSTSCG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 33/171 (19%)
7tm_1 91..347 CDD:278431 54/271 (20%)
Olr896NP_001000059.1 7tm_4 33..298 CDD:304433 55/287 (19%)
7tm_1 39..288 CDD:278431 54/271 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.