DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and GPR17

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001154887.1 Gene:GPR17 / 2840 HGNCID:4471 Length:367 Species:Homo sapiens


Alignment Length:337 Identity:83/337 - (24%)
Similarity:151/337 - (44%) Gaps:65/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AESVALERIVSTIVPVFFGIIGF-AGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFC 127
            ||....|..:..::...|.::.| ..|:||.|.:.:.:.:.:..:..|:.:::|||:|:..|:  
Human    48 AEQCGQETPLENMLFASFYLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVL-- 110

  Fly   128 VPFTATDYVLP----------EWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTS 182
                    |||          .||||.:.|:...::..:..:.|:|.|..:|.|||||:||||.|
Human   111 --------VLPTRLVYHFSGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKS 167

  Fly   183 MSLRTERNATLAIMCAWITIVTTAIPVALS-------HSVRIYQYHGNAGTACVFSTEEEIWSLV 240
            :.||....|.||....|:.:.....|:.:|       |:|...|         ::..:....:||
Human   168 LKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQ---------LYREKASHHALV 223

  Fly   241 GFQVSF---FLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAI 302
            ...|:|   |:::....|.:|..|..|:..              .::.|.:..||:.:|:..|.:
Human   224 SLAVAFTFPFITTVTCYLLIIRSLRQGLRV--------------EKRLKTKAVRMIAIVLAIFLV 274

  Fly   303 CWLPIHVILVLKALNL--YGGS----HLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKV 361
            |::|.||...:..|:.  :|.|    .:..:...|:..:...|..::||:|.|:::.||.|...:
Human   275 CFVPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNL 339

  Fly   362 VWCG----SPPP 369
            : ||    .|||
Human   340 L-CGKRLKGPPP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 44/174 (25%)
7tm_1 91..347 CDD:278431 67/281 (24%)
GPR17NP_001154887.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
7tm_1 76..325 CDD:278431 67/281 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.