DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and CXCR3

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001136269.1 Gene:CXCR3 / 2833 HGNCID:4540 Length:415 Species:Homo sapiens


Alignment Length:379 Identity:97/379 - (25%)
Similarity:175/379 - (46%) Gaps:73/379 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FTSEHTDHSDHNAND-----------SMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVIL 97
            |:|.: |:.::.::.           |:.:|          ...:|..:.::...||||||.|..
Human    70 FSSSY-DYGENESDSCCTSPPCPQDFSLNFD----------RAFLPALYSLLFLLGLLGNGAVAA 123

  Fly    98 VVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSV 162
            |:::.:...|:|:..:::|||:|.|.|: .:|..|.|..: :|.||:..||....:..:..:...
Human   124 VLLSRRTALSSTDTFLLHLAVADTLLVL-TLPLWAVDAAV-QWVFGSGLCKVAGALFNINFYAGA 186

  Fly   163 YTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIP----VALSHSVRIYQYHGN 223
            ..|..:||||:|.:||.............||..:..|...:..|:|    ::..|..|:     |
Human   187 LLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERL-----N 246

  Fly   224 AGTACVFSTEEEIWSLVG---FQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKG 285
            | |.|.::..:     ||   .:|...::.::.||.::.:.|..:||.|..|           :|
Human   247 A-THCQYNFPQ-----VGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVS-----------RG 294

  Fly   286 KRRV--TRMVVVVVLAFAICWLPIHVILVLKALNLYGG--------SHLSVIIQIISHVVAYTNS 340
            :||:  .|:|||||:|||:||.|.|:::::..|...|.        |.:.|...:.|. :.|.:.
Human   295 QRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSG-LGYMHC 358

  Fly   341 CINPILYAFLSDNFRKAFRKVVW-----CGSPPPLMTNQQVTKTTRTATGNGTS 389
            |:||:||||:...||:.    :|     .|.|......:|.:.:.|.::.:.||
Human   359 CLNPLLYAFVGVKFRER----MWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 43/160 (27%)
7tm_1 91..347 CDD:278431 75/272 (28%)
CXCR3NP_001136269.1 7tmA_CXCR3 101..376 CDD:341335 85/303 (28%)
TM helix 1 101..128 CDD:341335 9/26 (35%)
TM helix 2 135..160 CDD:341335 9/25 (36%)
TM helix 3 171..201 CDD:341335 8/29 (28%)
TM helix 4 213..235 CDD:341335 5/21 (24%)
TM helix 5 259..288 CDD:341335 5/28 (18%)
TM helix 6 295..325 CDD:341335 15/29 (52%)
TM helix 7 344..369 CDD:341335 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.