DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and NPBWR2

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_005277.2 Gene:NPBWR2 / 2832 HGNCID:4530 Length:333 Species:Homo sapiens


Alignment Length:361 Identity:107/361 - (29%)
Similarity:175/361 - (48%) Gaps:56/361 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KASWGATGNGSIISVSNSSGNNYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGII 84
            :.|:.....|:.:|..|.:|:|..|            ::.:.:          :..::|..:..|
Human    13 RGSFSLPTMGANVSQDNGTGHNATF------------SEPLPF----------LYVLLPAVYSGI 55

  Fly    85 GFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKF 149
            ...||.||..||||::...:|::.||:.|:||||:|.||.: .:|....:::|..||||.:.||.
Human    56 CAVGLTGNTAVILVILRAPKMKTVTNVFILNLAVADGLFTL-VLPVNIAEHLLQYWPFGELLCKL 119

  Fly   150 VQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTS--MSLRTERNATLAIMCAWITIVTTAIPVALS 212
            |..:.......|:|.|.:||.||:|.|:..|.|  |..||.|.|.:|.:|.|:.:....:|    
Human   120 VLAVDHYNIFSSIYFLAVMSVDRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLP---- 180

  Fly   213 HSVRIYQYHGNAGTACVFSTE-------------EEIWSLVGFQVSFFLSSYVAPLTLICFLYMG 264
                .:.:.|      |:|.|             |::| ....:|...:..:|.|:..||.||..
Human   181 ----FFSFAG------VYSNELQVPSCGLSFPWPEQVW-FKASRVYTLVLGFVLPVCTICVLYTD 234

  Fly   265 MLARLWKSAPGCKPSAES-RKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVII 328
            :|.||  .|...:..|:: .|.:|:||.:|:||:....:||.|.|:..|:........:.|.:.:
Human   235 LLRRL--RAVRLRSGAKALGKARRKVTVLVLVVLAVCLLCWTPFHLASVVALTTDLPQTPLVISM 297

  Fly   329 QIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364
            ..:...::|.|||:||.|||||.|||||.||.::.|
Human   298 SYVITSLSYANSCLNPFLYAFLDDNFRKNFRSILRC 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 55/171 (32%)
7tm_1 91..347 CDD:278431 83/271 (31%)
NPBWR2NP_005277.2 7tmA_NPBWR 46..327 CDD:320215 97/298 (33%)
TM helix 1 47..73 CDD:320215 10/25 (40%)
TM helix 2 80..106 CDD:320215 11/26 (42%)
TM helix 3 117..147 CDD:320215 11/29 (38%)
TM helix 4 161..183 CDD:320215 6/29 (21%)
TM helix 5 209..238 CDD:320215 8/28 (29%)
TM helix 6 253..283 CDD:320215 12/29 (41%)
TM helix 7 295..320 CDD:320215 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.