DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and GALR1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001471.2 Gene:GALR1 / 2587 HGNCID:4132 Length:349 Species:Homo sapiens


Alignment Length:306 Identity:119/306 - (38%)
Similarity:175/306 - (57%) Gaps:22/306 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQ--QMRSTTNLLIINLAVSDILFVIFCVP 129
            :.:|..|:.:|   ||:|...|:|||.|||.|:..::  :.||||||.|:||:::|:.:::||:|
Human    29 IGVENFVTLVV---FGLIFALGVLGNSLVITVLARSKPGKPRSTTNLFILNLSIADLAYLLFCIP 90

  Fly   130 FTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLA 194
            |.||.|.||.|..|...|||:.|...|:...|::||..||.||::|:||...|.|||..|||.|.
Human    91 FQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLG 155

  Fly   195 IMCAWITIVTTAIPVALSHSVRIYQYHGNAG--TACVFSTEEEIW----SLVGFQVSFFLSSYVA 253
            :.|.|...:..|.|||....:    :|..|.  |.|     .|.|    ....:.|..|:..|:.
Human   156 VGCIWALSIAMASPVAYHQGL----FHPRASNQTFC-----WEQWPDPRHKKAYVVCTFVFGYLL 211

  Fly   254 PLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNL 318
            ||.||||.|..:|..|.|.....  |.:|...|::..:.|:|||:.|.|.|||.|:|.:.....:
Human   212 PLLLICFCYAKVLNHLHKKLKNM--SKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGV 274

  Fly   319 YGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364
            :..:..|.:.:|.:|.:||:||.:|||:|||||:|||||:::|..|
Human   275 FPLTPASFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 65/164 (40%)
7tm_1 91..347 CDD:278431 99/263 (38%)
GALR1NP_001471.2 7tm_1 50..303 CDD:278431 99/263 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3617
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3667
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 1 1.000 - - FOG0000972
OrthoInspector 1 1.000 - - mtm9822
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.