DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Oprm1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001033690.1 Gene:Oprm1 / 25601 RGDID:3234 Length:468 Species:Rattus norvegicus


Alignment Length:361 Identity:117/361 - (32%)
Similarity:186/361 - (51%) Gaps:22/361 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GSIISVSNSSGNNYAFTSEHTDHSDHN-----ANDSMEYDAESVALERIVSTIVPVFFGIIGFAG 88
            ||.:::|:..||       .:|....|     .|||:.....|.::  :.:..:...:.|:...|
  Rat    27 GSWLNLSHVDGN-------QSDPCGLNRTGLGGNDSLCPQTGSPSM--VTAITIMALYSIVCVVG 82

  Fly    89 LLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYM 153
            |.||.||:.|:|...:|::.||:.|.|||::|.| ....:||.:.:|::..||||.:.||.|..:
  Rat    83 LFGNFLVMYVIVRYTKMKTATNIYIFNLALADAL-ATSTLPFQSVNYLMGTWPFGTILCKIVISI 146

  Fly   154 IVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIY 218
            .......|::||..||.||::||.|||.::..||.|||.:..:|.||......:||....:.:..
  Rat   147 DYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYR 211

  Fly   219 QYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESR 283
            |  |:......||.....|..: .::..|:.:::.|:.:|...|..|:.|| ||......|.|..
  Rat   212 Q--GSIDCTLTFSHPTWYWENL-LKICVFIFAFIMPVLIITVCYGLMILRL-KSVRMLSGSKEKD 272

  Fly   284 KGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYA 348
            :..||:||||:|||..|.:||.|||:.:::|||.....:....:.......:.|||||:||:|||
  Rat   273 RNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYA 337

  Fly   349 FLSDNFRKAFRKVVWCGSPPPLMTNQQVTKTTRTAT 384
            ||.:||::.||:  :| .|......||.:...|..|
  Rat   338 FLDENFKRCFRE--FC-IPTSSTIEQQNSTRVRQNT 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 55/156 (35%)
7tm_1 91..347 CDD:278431 88/255 (35%)
Oprm1NP_001033690.1 7tm_4 77..>281 CDD:304433 69/208 (33%)
7tm_1 85..336 CDD:278431 88/255 (35%)
NPxxY, plays a role in stabilizing the activated conformation of the receptor. /evidence=ECO:0000250|UniProtKB:P42866 332..336 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..385 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.