DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Sstr4

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_037168.1 Gene:Sstr4 / 25555 RGDID:3764 Length:384 Species:Rattus norvegicus


Alignment Length:355 Identity:107/355 - (30%)
Similarity:177/355 - (49%) Gaps:69/355 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWP 141
            :...:.::...||:||.|||.|::...:|::.||:.::||||:|.||:: .|||.|:...|..||
  Rat    46 IQCIYALVCLVGLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFML-SVPFVASAAALRHWP 109

  Fly   142 FGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTA 206
            ||.|.|:.|..:..:....||:.|.::|.||::|||||:.:.:.|....|.|..:..|:..:...
  Rat   110 FGAVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVT 174

  Fly   207 IPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARL-- 269
            :|:|:....|  ...|....||........||.| |.:..||..::.|:..|...|:.::.::  
  Rat   175 LPIAVFADTR--PARGGEAVACNLHWPHPAWSAV-FVIYTFLLGFLLPVLAIGLCYLLIVGKMRA 236

  Fly   270 ------WKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVII 328
                  |:         :.|:.::::||:|::||..|.:||:|.:|:   :.|||:..| |...:
  Rat   237 VALRAGWQ---------QRRRSEKKITRLVLMVVTVFVLCWMPFYVV---QLLNLFVTS-LDATV 288

  Fly   329 QIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC---------------------------GS 366
            ..:|.:::|.|||.|||||.|||||||::|::|: |                           |.
  Rat   289 NHVSLILSYANSCANPILYGFLSDNFRRSFQRVL-CLRCCLLETTGGAEEEPLDYYATALKSRGG 352

  Fly   367 P----PPLMTNQQ------------VTKTT 380
            |    |||...|:            .||||
  Rat   353 PGCICPPLPCQQEPMQAEPACKRVPFTKTT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 53/156 (34%)
7tm_1 91..347 CDD:278431 83/263 (32%)
Sstr4NP_037168.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
7tm_4 52..283 CDD:304433 75/246 (30%)
7tm_1 60..307 CDD:278431 83/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.