DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Cmklr2

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_037093.1 Gene:Cmklr2 / 25457 RGDID:2728 Length:353 Species:Rattus norvegicus


Alignment Length:383 Identity:94/383 - (24%)
Similarity:168/383 - (43%) Gaps:75/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NNYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQ 104
            :||::..|:.         |.|.|||......||..|..:.:.:....|:.||.:||. .:..:.
  Rat    13 DNYSYALEYY---------SQEPDAEENVYPGIVHWISLLLYALAFVLGIPGNAIVIW-FMGFKW 67

  Fly   105 MRSTTNLLIINLAVSDILFVIFC---VPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLV 166
            .::.|.|..:|||::|.:||:|.   :.:.|..:   .||||...||...::..:....||:.|.
  Rat    68 KKTVTTLWFLNLAIADFIFVLFLPLYISYVALSF---HWPFGRWLCKLNSFIAQLNMFSSVFFLT 129

  Fly   167 LMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIP-VALSHSVRIYQYHGNAGTACVF 230
            ::|.||::.::||..|...||.:|:.|.::..|:.......| :....:|.:     |....|..
  Rat   130 VISLDRYIHLIHPGLSHPHRTLKNSLLVVLFVWLLASLLGGPTLYFRDTVEV-----NNRIICYN 189

  Fly   231 STEEEIWSLVGFQVSF---FLSSYVAPLTLICFLYMGMLAR------------LWKSAPGCKPSA 280
            :.:|...:|:...|..   ||..|:.||..:...|:.::.:            ||          
  Rat   190 NFQEYELTLMRHHVLTWVKFLFGYLLPLLTMSSCYLCLIFKTKKQNILISSKHLW---------- 244

  Fly   281 ESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQ---IISHVVAYTNSCI 342
                       |::.||:||.:||.|.|:..:.: |:::..|....::|   .:|..:|:.|||:
  Rat   245 -----------MILSVVIAFMVCWTPFHLFSIWE-LSIHHNSSFQNVLQGGIPLSTGLAFLNSCL 297

  Fly   343 NPILYAFLSDNFRKAFR--------KVVWCGSPPPLMTNQQVTKTTRTATGNGTSNIE 392
            |||||..:|..|:..||        :.:|..|     .:..|::..|:|.....|.:|
  Rat   298 NPILYVIISKKFQARFRASVAEVLKRSLWEAS-----CSGTVSEQLRSAETKSLSLLE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 40/160 (25%)
7tm_1 91..347 CDD:278431 69/277 (25%)
Cmklr2NP_037093.1 7tm_1 55..302 CDD:278431 69/277 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.