DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Oprd1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_036749.1 Gene:Oprd1 / 24613 RGDID:3233 Length:372 Species:Rattus norvegicus


Alignment Length:389 Identity:119/389 - (30%)
Similarity:186/389 - (47%) Gaps:62/389 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALLLATLISSWPKASWGATGNGSIISVSNSSGNNYAFTSEHTDHSDHNANDSMEYDAESVALER 71
            ||.:..|..|::|.||..|:|:....|.|:.                          |.::|:..
  Rat    16 LANVSDTFPSAFPSASANASGSPGARSASSL--------------------------ALAIAITA 54

  Fly    72 IVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYV 136
            :.|.:..|        |||||.||:..:|...::::.||:.|.|||::|.| ....:||.:..|:
  Rat    55 LYSAVCAV--------GLLGNVLVMFGIVRYTKLKTATNIYIFNLALADAL-ATSTLPFQSAKYL 110

  Fly   137 LPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWIT 201
            :..||||.:.||.|..:.......|::||.:||.||::||.|||.::..||...|.|..:|.|:.
  Rat   111 METWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVL 175

  Fly   202 IVTTAIPVALSHSVRIYQYHGNAGTACV--FSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMG 264
            .....:|:.:   :.:.|....| ..|.  |.:....|..| .::..||.::|.|:.:|...|..
  Rat   176 ASGVGVPIMV---MAVTQPRDGA-VVCTLQFPSPSWYWDTV-TKICVFLFAFVVPILIITVCYGL 235

  Fly   265 MLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKAL--------NLYGG 321
            ||.|| :|......|.|..:..||:||||:|||.||.:||.|||:.:::..|        .:...
  Rat   236 MLLRL-RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAA 299

  Fly   322 SHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKV--VWCGSPPP--LMTNQQVTKTTR 381
            .||.:       .:.|.||.:||:|||||.:||::.||::  ..||...|  |...:|.|...|
  Rat   300 LHLCI-------ALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARER 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 50/158 (32%)
7tm_1 91..347 CDD:278431 85/265 (32%)
Oprd1NP_036749.1 7tm_4 59..>232 CDD:304433 57/186 (31%)
7tm_1 66..318 CDD:278431 85/265 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..372 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.