DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Gpr1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001343974.1 Gene:Gpr1 / 241070 MGIID:2385324 Length:353 Species:Mus musculus


Alignment Length:374 Identity:88/374 - (23%)
Similarity:167/374 - (44%) Gaps:57/374 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NNYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQ 104
            :||::..::.         |.|.|.|......:|..|....:.:....|:.||.:||. ::..:.
Mouse    13 DNYSYALDYY---------SQESDPEEKVYLGLVHWISLFLYALAFVLGIPGNAIVIW-LMGFKW 67

  Fly   105 MRSTTNLLIINLAVSDILFVIFC---VPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLV 166
            .::.|.|..:|||::|.:||:|.   :.:.|..:   .||||...||...::..:....||:.|.
Mouse    68 KKTVTTLWFLNLAIADFIFVLFLPLYISYVALSF---HWPFGLWLCKVNSFIAQLNMFSSVFFLT 129

  Fly   167 LMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFS 231
            ::|.||::.::||..|...||.:::.:.::..|:.......|............|    ..|..:
Mouse   130 VISLDRYIHLLHPGLSHRHRTLKSSLVVVILVWLLASLLGGPTLYFRDTMEVNNH----IICYNN 190

  Fly   232 TEEEIWSLVGFQVSF---FLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTR-- 291
            .:|...:|:...|..   ||..|:.||..:...|:.::.::             :|....::|  
Mouse   191 FQEHELTLMRHHVLTWVKFLFGYLFPLLTMSSCYLCLIFKM-------------KKRNILISRKH 242

  Fly   292 --MVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQ---IISHVVAYTNSCINPILYAFLS 351
              |::.||:||.:||.|.|:..:.: |:::..|....::|   .:|..:|:.|||:|||||..:|
Mouse   243 LWMILSVVIAFLVCWTPYHLFSIWE-LSIHHNSSFQNVLQGGIPLSTGLAFLNSCLNPILYVLIS 306

  Fly   352 DNFRKAFR--------KVVWCGSPPPLMTNQQVTKTTRTATGNGTSNIE 392
            ..|:..||        :.:|..|     .:..|::..|:|.....|.:|
Mouse   307 KTFQARFRASVAEVLKRSLWEAS-----CSGTVSEQLRSAETKSLSLLE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 37/159 (23%)
7tm_1 91..347 CDD:278431 66/268 (25%)
Gpr1NP_001343974.1 7tmA_GPR1 39..313 CDD:320247 72/295 (24%)
TM helix 1 40..66 CDD:320247 6/26 (23%)
TM helix 2 72..97 CDD:320247 9/24 (38%)
TM helix 3 110..140 CDD:320247 8/29 (28%)
TM helix 4 152..172 CDD:320247 1/19 (5%)
TM helix 5 201..226 CDD:320247 7/24 (29%)
TM helix 6 237..267 CDD:320247 10/29 (34%)
TM helix 7 281..306 CDD:320247 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.