DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Gpr149

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_620246.1 Gene:Gpr149 / 192251 RGDID:619890 Length:730 Species:Rattus norvegicus


Alignment Length:396 Identity:70/396 - (17%)
Similarity:126/396 - (31%) Gaps:135/396 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FTSEHTDHS-----DHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQ 103
            |.|..|:.|     .||:.|.|. ..|::.|.......:.....::|       .:..||.:...
  Rat     4 FLSNLTNDSRLWKVSHNSTDLMN-SPETLTLSLFCLICLMTLVALVG-------SIFSLVSLLTM 60

  Fly   104 QMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWP-----FGNVWCKFVQYMIVVTCHCSVY 163
            |.|:..::|:.:.:|.|:|.|:     :...:::.:||     :....|.....:.:.....|..
  Rat    61 QYRTVVSMLVTSWSVDDLLSVL-----SVAIFMVLQWPREAPGYFQSLCTTSALLYMCQGLSSNL 120

  Fly   164 TLVLMSFDRFLAVVHPVTSMSLRTERNATLAI---------------MCAWITIVTT-------- 205
            ...|:.|..|..:...|.|.|........|.:               :|.|...|.|        
  Rat   121 KATLIVFYNFYTMHRTVVSQSSSWRSGQVLGVALTVWAVSLLLASLPLCGWGVFVRTPWGCLTDC 185

  Fly   206 --------------------AIPVALSHSVRIYQ----YHGN---------------AG--TACV 229
                                .:.|.|:|.:...:    .|.|               ||  ..|:
  Rat   186 SSPYVLLLFAVYASAFGLLAVLSVPLTHQLLCSEEPPRLHANYQEISRGASTPGTPAAGGRVLCL 250

  Fly   230 FSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRR------ 288
            ...:.||.:|.|...|  |||.:.                  .|||...::.:..|||.      
  Rat   251 LPEDVEIPALPGTGSS--LSSDMV------------------FAPGQPAASSAGAGKRENLWTPR 295

  Fly   289 ----------VTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHL----SVIIQIISHVVAYTN 339
                      ..|..:::.|...|.|||:.:.:|:|        |:    |:.:.::|.::....
  Rat   296 GSSSFPVSLAQKRFALILALTKVILWLPMMIHMVVK--------HVVGFQSLPVDMLSFLLTLLA 352

  Fly   340 SCINPI 345
            |.:.|:
  Rat   353 STVTPV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 35/225 (16%)
7tm_1 91..347 CDD:278431 59/344 (17%)
Gpr149NP_620246.1 7tm_1 54..>209 CDD:278431 24/159 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.