DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Ptafr

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001074680.1 Gene:Ptafr / 19204 MGIID:106066 Length:341 Species:Mus musculus


Alignment Length:329 Identity:84/329 - (25%)
Similarity:142/329 - (43%) Gaps:54/329 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTN---LLII 114
            :||.  |...|:|      ...|:.|:.:.:|...|::.||.| |.|.||.......|   :.::
Mouse     2 EHNG--SFRVDSE------FRYTLFPIVYSVIFILGVVANGYV-LWVFANLYPSKKLNEIKIFMV 57

  Fly   115 NLAVSDILFVIFCVP------FTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRF 173
            ||.::|:||:| .:|      :...|::||     |..|.....:..:..:|||..|.:::::|:
Mouse    58 NLTMADLLFLI-TLPLWIVYYYNEGDWILP-----NFLCNVAGCLFFINTYCSVAFLGVITYNRY 116

  Fly   174 LAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAG--TACVFSTEE-- 234
            .||.:|:.:....|.:......:..|::||.||.....:.|..:......:|  |.|....|.  
Mouse   117 QAVAYPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPYS 181

  Fly   235 ------EIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKG--KRRVTR 291
                  .::....|.:.|||..| ..|.:|..|.             .:|..:.||.  |||...
Mouse   182 VPILVVHVFIAFCFFLVFFLIFY-CNLVIIHTLL-------------TQPMRQQRKAGVKRRALW 232

  Fly   292 MVVVVVLAFAICWLPIHVILV---LKALNLYGGSHLSV-IIQIISHVVAYTNSCINPILYAFLSD 352
            ||..|:..|.||::|.||:.:   |..|......|.:: ....|:..:..||..::|::|.||:.
Mouse   233 MVCTVLAVFIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTK 297

  Fly   353 NFRK 356
            .|||
Mouse   298 KFRK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 41/175 (23%)
7tm_1 91..347 CDD:278431 69/280 (25%)
PtafrNP_001074680.1 7tm_1 33..292 CDD:278431 69/279 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.