Sequence 1: | NP_524700.1 | Gene: | AstA-R1 / 44126 | FlyBaseID: | FBgn0266429 | Length: | 394 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504761.2 | Gene: | srx-59 / 188258 | WormBaseID: | WBGene00005950 | Length: | 308 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 47/203 - (23%) |
---|---|---|---|
Similarity: | 84/203 - (41%) | Gaps: | 32/203 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 GIIGF-AGLLG---NGLVILVVVANQQMRSTTNLLIINLAVSDIL----FVIFCVPFTAT-DYVL 137
Fly 138 PEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITI 202
Fly 203 VTTAIPVALSHSVRIYQ----YHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYM 263
Fly 264 GMLARLWK 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
AstA-R1 | NP_524700.1 | 7tm_4 | 83..>240 | CDD:304433 | 37/169 (22%) |
7tm_1 | 91..347 | CDD:278431 | 43/193 (22%) | ||
srx-59 | NP_504761.2 | TM helix 1 | 11..34 | CDD:341315 | 6/22 (27%) |
7TM_GPCR_Srx | 14..274 | CDD:370981 | 46/199 (23%) | ||
TM helix 2 | 41..67 | CDD:341315 | 6/25 (24%) | ||
TM helix 3 | 79..108 | CDD:341315 | 8/31 (26%) | ||
TM helix 4 | 121..149 | CDD:341315 | 6/35 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |