DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-19

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_501057.3 Gene:srx-19 / 188098 WormBaseID:WBGene00005910 Length:297 Species:Caenorhabditis elegans


Alignment Length:291 Identity:60/291 - (20%)
Similarity:110/291 - (37%) Gaps:78/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDI----LFVIFCVP 129
            ::.:::.::..|       ||:.|.:|:|.......|||:..::..|.||.:|    ||:||..|
 Worm     7 IDAMITVVIMTF-------GLITNIIVLLTARKMSSMRSSFGIITKNQAVCNILMCLLFLIFVGP 64

  Fly   130 FTATDYVLPEWP---FGNVWCKFVQYMIVVTCH--------CSVYTLVLMSFDRFLAVVHPVTSM 183
            ...|...||...   .|.|  ..:.|.|....:        |:||.:.|  :||..      ::.
 Worm    65 LHFTSLKLPYKASRFVGTV--SMIIYEIAAQLNFFNSLNRFCAVYMIFL--YDRIF------SNF 119

  Fly   184 SLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVGF------ 242
            :....||              .|:.|::......|::.|     |....|:|.| |..:      
 Worm   120 NTYMLRN--------------FAVVVSIGMCFTFYEFLG-----CYLYFEQESW-LFSYPENDVR 164

  Fly   243 --QVSFFLSSYVAPLTLICFLYMGMLA--------RLWKSAPGCKPSAESRKGKRRVTR------ 291
              |::::.........::..|::.:||        |:...:.|...|.:.|:.:....|      
 Worm   165 CDQLTWYCDFIFNMSLVVATLFLNLLAAYKARKLHRIVSDSTGVGMSKDQRQREFNFIRQSFFQG 229

  Fly   292 MVVVVVLAFAICWLPI---HVILVLKALNLY 319
            :.:.|.|.|.....|:   .::|.|.| ||:
 Worm   230 LSMSVALIFYRITAPMLENQILLFLDA-NLW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 40/171 (23%)
7tm_1 91..347 CDD:278431 57/269 (21%)
srx-19NP_501057.3 TM helix 1 9..33 CDD:341315 6/30 (20%)
7TM_GPCR_Srx 14..274 CDD:370981 60/284 (21%)
TM helix 2 40..66 CDD:341315 9/25 (36%)
TM helix 3 78..107 CDD:341315 5/30 (17%)
TM helix 4 120..139 CDD:341315 4/32 (13%)
TM helix 5 166..190 CDD:341315 2/23 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.