DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-36

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_504807.2 Gene:srx-36 / 187946 WormBaseID:WBGene00005927 Length:300 Species:Caenorhabditis elegans


Alignment Length:302 Identity:55/302 - (18%)
Similarity:121/302 - (40%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILF-VIFCVPFTATDY 135
            ::..|:||     ...|::.|.||:..::.|:.:..:.:||..|.|:.:.:| |::.|      |
 Worm     7 LILAIIPV-----NMIGIVTNWLVVTAIILNKTVNHSFSLLTSNQAIFNGVFSVVYLV------Y 60

  Fly   136 VLPEWPFGNVWCKF----VQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAI- 195
            |:|...|.:.:.|.    |.:::::....|::...:::.:||.||..|:...:|.:.....:.| 
 Worm    61 VVPMIFFDSSFMKLNVHHVAFILLICYDASIHAHAIITINRFCAVFLPIAYKTLLSSTRTKVIIA 125

  Fly   196 -----MCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPL 255
                 ..|::||:....|..:.::..:...:.:......:|...:|..|:.|.:   .:..:..:
 Worm   126 FSFILSLAFLTILFQIYPCQMYYNKELGLVYTDLPICMTYSKYGDIGKLISFSI---FNVIIDTI 187

  Fly   256 TLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVV----------VVVLAFAICWLPIHVI 310
            |            :||..     ...|:.||.:.|...:          :.:|....|::.|.:.
 Worm   188 T------------VWKVR-----KVRSQHGKHKFTNKEIDFLKQSFSQAIYLLVTTSCFVIIPMY 235

  Fly   311 LVLKALNLYGGSHLSVIIQIISHVVA-YTNSCINPILYAFLS 351
            :......|..|:.....|..:...:. |.|:.|...|..:.|
 Worm   236 ITNPVAELIMGTFFWPTIHALDGAITLYFNTEIQRSLLKYCS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 32/167 (19%)
7tm_1 91..347 CDD:278431 49/277 (18%)
srx-36NP_504807.2 TM helix 1 7..32 CDD:341315 7/29 (24%)
7TM_GPCR_Srx 12..265 CDD:370981 50/283 (18%)
TM helix 2 39..64 CDD:341315 9/30 (30%)
TM helix 3 76..106 CDD:341315 5/29 (17%)
TM helix 4 119..138 CDD:341315 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.