DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-65

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_504086.2 Gene:srx-65 / 187096 WormBaseID:WBGene00005956 Length:293 Species:Caenorhabditis elegans


Alignment Length:173 Identity:33/173 - (19%)
Similarity:65/173 - (37%) Gaps:30/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDIL----FVIFCVP 129
            :::|:..:||     |...|.:.|......:......:.:...|..|.|::|.|    |:::..|
 Worm     4 VDQILLVLVP-----ISIVGAVLNWSSFYSICKLTSYKHSFGYLSANQALADALHSTIFLLYFCP 63

  Fly   130 FTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLA 194
            ....|:     .|...:..|..::::.....|:.|.:.:||.||.::..||............:.
 Worm    64 MALLDH-----SFLKQYSHFCGFILLFFYELSIMTHLAVSFKRFFSIWFPVIFKKHFDVPRTKVV 123

  Fly   195 IMCAW-ITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEI 236
            |...| .|::...:         :|:      ..|.|..:|||
 Worm   124 IGVLWCYTLIQATV---------LYE------VLCYFYFDEEI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 30/159 (19%)
7tm_1 91..347 CDD:278431 28/151 (19%)
srx-65NP_504086.2 TM helix 1 7..32 CDD:341315 6/29 (21%)
7TM_GPCR_Srx 13..272 CDD:370981 31/164 (19%)
TM helix 2 39..65 CDD:341315 7/25 (28%)
TM helix 3 77..106 CDD:341315 7/28 (25%)
TM helix 4 119..138 CDD:341315 3/27 (11%)
TM helix 5 163..188 CDD:341315
TM helix 6 213..243 CDD:341315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.