DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-64

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001317762.1 Gene:srx-64 / 187095 WormBaseID:WBGene00005955 Length:302 Species:Caenorhabditis elegans


Alignment Length:245 Identity:53/245 - (21%)
Similarity:89/245 - (36%) Gaps:72/245 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 MRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCH-CSVYTLVLM 168
            |.|||             |:||..|....|.  |.....:..|.||    ::.|: .||...:.:
 Worm    53 MHSTT-------------FLIFFCPMVLLDE--PTLKAMSHHCGFV----LLLCYELSVMIHLAI 98

  Fly   169 SFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTE 233
            |.:||.||..|....::.::||.  .|:..::..||        .|:.||.|.    .:|.|..:
 Worm    99 SLNRFCAVWAPYKYQNIFSDRNT--KILIGFVGTVT--------GSIAIYFYE----VSCHFYYD 149

  Fly   234 EEIWSL----------VGFQVSFFLSSYVAP-------LTLICFLYMG--MLARLWKSAPGCKPS 279
            |:|..|          :|:...|..::.:..       ||::....|.  :.:.:...|.....|
 Worm   150 EKIHFLTFTNSEFCGYIGWYGDFLKNAVIVAIVVSIDILTVVKVKQMSKKISSSISDQAHSNLTS 214

  Fly   280 AESRKGKRRVTRMVV-------------------VVVLAFAICWLPIHVI 310
            .|.|..|:.||:..|                   :|..|.:..|:.:|.:
 Worm   215 REIRFLKQTVTQGSVFMLELLTYFFVPRYFANRWIVFFATSFAWVAVHAV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 36/145 (25%)
7tm_1 91..347 CDD:278431 53/245 (22%)
srx-64NP_001317762.1 TM helix 1 8..33 CDD:341315
7TM_GPCR_Srx 14..273 CDD:370981 53/245 (22%)
TM helix 2 40..66 CDD:341315 8/25 (32%)
TM helix 3 77..107 CDD:341315 10/33 (30%)
TM helix 4 120..138 CDD:341315 5/27 (19%)
TM helix 5 163..188 CDD:341315 2/24 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.