Sequence 1: | NP_524700.1 | Gene: | AstA-R1 / 44126 | FlyBaseID: | FBgn0266429 | Length: | 394 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001317762.1 | Gene: | srx-64 / 187095 | WormBaseID: | WBGene00005955 | Length: | 302 | Species: | Caenorhabditis elegans |
Alignment Length: | 245 | Identity: | 53/245 - (21%) |
---|---|---|---|
Similarity: | 89/245 - (36%) | Gaps: | 72/245 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 MRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCH-CSVYTLVLM 168
Fly 169 SFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTE 233
Fly 234 EEIWSL----------VGFQVSFFLSSYVAP-------LTLICFLYMG--MLARLWKSAPGCKPS 279
Fly 280 AESRKGKRRVTRMVV-------------------VVVLAFAICWLPIHVI 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
AstA-R1 | NP_524700.1 | 7tm_4 | 83..>240 | CDD:304433 | 36/145 (25%) |
7tm_1 | 91..347 | CDD:278431 | 53/245 (22%) | ||
srx-64 | NP_001317762.1 | TM helix 1 | 8..33 | CDD:341315 | |
7TM_GPCR_Srx | 14..273 | CDD:370981 | 53/245 (22%) | ||
TM helix 2 | 40..66 | CDD:341315 | 8/25 (32%) | ||
TM helix 3 | 77..107 | CDD:341315 | 10/33 (30%) | ||
TM helix 4 | 120..138 | CDD:341315 | 5/27 (19%) | ||
TM helix 5 | 163..188 | CDD:341315 | 2/24 (8%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |