DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-104

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_494618.2 Gene:srx-104 / 185583 WormBaseID:WBGene00005995 Length:279 Species:Caenorhabditis elegans


Alignment Length:307 Identity:57/307 - (18%)
Similarity:112/307 - (36%) Gaps:71/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLII----NLAVSDILFVIFCVPF 130
            :.|.:.:|.....::.|.|:|.|..:....:..|:    |:..::    .::.|.|||.      
 Worm     4 DEIATRLVGAHMLLVSFCGILINFYMFYFFLKLQK----TSFYVLCSSKTISNSIILFA------ 58

  Fly   131 TATDYVLPEWPFGNVWCKF----VQYMIVVTCHCSVY-----TLVLMSFDRFLAVVHPVTSMSLR 186
                |:|...|....:..|    :...|.......:|     |.::::.:|||.|.......:..
 Worm    59 ----YLLYVGPINFFYSGFGSAVLSSYINQAMGYGIYLQGPITQLMITVNRFLVVWISAAKTTSD 119

  Fly   187 TERNATLAIMCAWI------TIV----TTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVG 241
            :.:...:|:..:|:      |::    ...:||.|.|.       |...:.|.....:.:: |..
 Worm   120 STKVTVVALAFSWVFATWFSTLLGLPDNCRVPVDLEHV-------GYTSSECSVQVIDYLF-LAV 176

  Fly   242 FQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAIC--- 303
            |.:..|.:  |..:::...||:     :.||:......|...:.|.|       |.|....|   
 Worm   177 FLLGVFTN--VLNVSIAIKLYL-----ISKSSNLLSSRASKTRNKNR-------VYLFLQSCFQD 227

  Fly   304 WLPIHVILVLKALNLYGGSH---------LSVIIQIISHVVAYTNSC 341
            |:.:.|||.....::|..||         |.|::..:...:.|..:|
 Worm   228 WIAVLVILNNILASMYCRSHVCTNLITMGLDVVVYALDGFIMYLFNC 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 30/179 (17%)
7tm_1 91..347 CDD:278431 52/286 (18%)
srx-104NP_494618.2 7TM_GPCR_Srx 17..273 CDD:370981 54/291 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.