DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-46

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_505423.1 Gene:srx-46 / 183984 WormBaseID:WBGene00005937 Length:317 Species:Caenorhabditis elegans


Alignment Length:356 Identity:70/356 - (19%)
Similarity:124/356 - (34%) Gaps:96/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDIL-----FVIFCVPFTATDY-VL 137
            :||  :...|:..|..|:|.:........:...:..|.|..|.|     |.: .||....|. ||
 Worm    12 LFF--VSLTGVFTNWTVLLFLPKVSSFNKSFGYITWNQAFGDALQSTTVFTL-VVPMVFFDLEVL 73

  Fly   138 PEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITI 202
                  .....::...:::....||.:.:|::.:|...|..|   :...|........|...:.|
 Worm    74 ------KANSNYISLSMLLGYDISVLSHLLLALNRLCVVASP---LKFETYNEKYTRPMIISVNI 129

  Fly   203 VTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIW--------SLVGFQVSFFLSSYVAPLTLIC 259
            ...|       ||.|:...|     |.:|...|:|        ..|.|........|::.:.:|.
 Worm   130 YAFA-------SVIIFLLSG-----CKYSWSTEMWMFLYHVSNQCVSFSFYAIFCKYISIIFIIV 182

  Fly   260 FLYMGMLAR---LWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVIL--VLKALNLY 319
            .:.:.::.:   ::|.:   |..|:|::...:            .||:| :...|  ||.::.| 
 Worm   183 LIDVFVICKARFMYKKS---KNDAKSKQMNSK------------EICFL-VQTCLQGVLFSIEL- 230

  Fly   320 GGSHLSVIIQIISHVVAYT--------------NSCINPILYAFLSDNFRKAFRKVVWCG----- 365
                  :...|||..|..|              ::|...|..|..|| ||...|:   |.     
 Worm   231 ------ICYFIISPRVEDTWVRFFMTTFAFSTIHACDGAISIACNSD-FRSYLRR---CSMKKIS 285

  Fly   366 --SPPPLMTNQQVTKT-----TRTATGNGTS 389
              :...|..::..|.|     :||:|.|.::
 Worm   286 NRTESALYASRVDTSTLGGFRSRTSTINASA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 32/170 (19%)
7tm_1 91..347 CDD:278431 53/288 (18%)
srx-46NP_505423.1 TM helix 1 11..33 CDD:341315 6/22 (27%)
7TM_GPCR_Srx 13..269 CDD:370981 57/302 (19%)
TM helix 2 40..66 CDD:341315 7/26 (27%)
TM helix 3 77..107 CDD:341315 4/29 (14%)
TM helix 4 119..138 CDD:341315 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.