DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-13

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001343636.1 Gene:srx-13 / 183437 WormBaseID:WBGene00005904 Length:325 Species:Caenorhabditis elegans


Alignment Length:215 Identity:49/215 - (22%)
Similarity:93/215 - (43%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLII--NLAVSDILFVIFC 127
            :.:..|.::.....:||  :.|.||:.|.|.|.||:.|..::::...|.:  ::|.|.:|||.| 
 Worm    19 QEITREDVLLAAAIIFF--VAFFGLIFNLLGITVVMKNPILKNSFGTLCLSHSIANSGVLFVFF- 80

  Fly   128 VPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNAT 192
            :....|.|:..: ..|.:..|.:..:.::.....||:.:.:||:||.::..|..::.:.:.:|..
 Worm    81 IWSAPTTYIQAQ-NVGGMLGKLLGQLNILCWDACVYSHLAISFNRFFSIAIPARAIFIFSRQNTL 144

  Fly   193 LAIMCAWITIVTTAIPVALSHSVRIYQYH-------------GNAGTAC--VFSTEEEIWSLVGF 242
            :.|...|.        :|..|....:.|.             ..|.|.|  |.||..:.::.|..
 Worm   145 VIIGIVWF--------IAFCHIFPYFWYDKCFITYNPISWTWNFAPTECGHVISTYTDYYTSVAI 201

  Fly   243 QVSFFLSSYVAPLTLICFLY 262
               |...|.|..:|||..::
 Worm   202 ---FIAMSSVDIMTLILLIF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 39/173 (23%)
7tm_1 91..347 CDD:278431 43/189 (23%)
srx-13NP_001343636.1 TM helix 1 30..53 CDD:381740 10/24 (42%)
7TM_GPCR_Srx 34..295 CDD:370981 48/200 (24%)
TM helix 2 62..84 CDD:381740 7/22 (32%)
TM helix 3 100..122 CDD:381740 3/21 (14%)
TM helix 4 145..161 CDD:381740 4/23 (17%)
TM helix 5 187..215 CDD:381740 9/30 (30%)
TM helix 6 239..259 CDD:381740
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.