DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-58

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_506809.3 Gene:srx-58 / 183007 WormBaseID:WBGene00005949 Length:211 Species:Caenorhabditis elegans


Alignment Length:98 Identity:18/98 - (18%)
Similarity:38/98 - (38%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 YMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWI---------------- 200
            :::.|....||.|..::|.:||::|..|:...::...:...|.|...|:                
 Worm    18 FLVAVFHDVSVLTHFIISLNRFISVWCPIFYKTMFNLKYTKLFIFAVWLISFLIGSLFHIVLCRI 82

  Fly   201 ----TIVTTAIPVALSHSVRIYQYHGNAGTACV 229
                .::...|.:|.|:...|.:|......:|:
 Worm    83 RFNADLILFTIILAPSYCFEIGRYGDLFRNSCI 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 18/98 (18%)
7tm_1 91..347 CDD:278431 18/98 (18%)
srx-58NP_506809.3 7TM_GPCR_Srx <12..188 CDD:370981 18/98 (18%)
TM helix 3 14..43 CDD:341315 7/24 (29%)
TM helix 4 56..74 CDD:341315 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.