DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and srx-38

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_504380.2 Gene:srx-38 / 182137 WormBaseID:WBGene00005929 Length:294 Species:Caenorhabditis elegans


Alignment Length:246 Identity:55/246 - (22%)
Similarity:107/246 - (43%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATD 134
            |:||:.|:.||    ...|...|..::::::...:::....:|.:.||::|.:|....: |.||.
 Worm     4 EKIVAAIMIVF----SSCGFFTNWAIVILMIKVTKLQKPFAILTVGLAIADGVFSTLYL-FYATP 63

  Fly   135 YVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAW 199
            .|..:..|.:.|.....|.:::....|.|...::|.:|||||..||....:.:.....|.:|..:
 Worm    64 MVFFQNEFLDYWSHLCGYFLMICYDASTYFHFIISLNRFLAVFTPVLYHKMFSITFTKLIVMATY 128

  Fly   200 I---TIVTTAIPVA-----LSHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFF-LSSYVAPL 255
            :   .::|....:.     .:...|.:||.|.|           |.||.|....|: :.:.....
 Worm   129 LLSFILITLFFQILGCQNYYNAEYRAFQYSGGA-----------ICSLYGTYGDFYQVFTLTITS 182

  Fly   256 TLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLP 306
            ||:.|..:|.:.::...:.  |.|.|....|:.:::.:.|:|:.....|.|
 Worm   183 TLLDFTAIGKVVKMRSKSD--KNSKELSLLKQSLSQTLFVLVIVCCFTWGP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 34/164 (21%)
7tm_1 91..347 CDD:278431 48/225 (21%)
srx-38NP_504380.2 TM helix 1 8..31 CDD:381740 5/26 (19%)
7TM_GPCR_Srx 12..263 CDD:370981 51/238 (21%)
TM helix 2 40..61 CDD:381740 6/21 (29%)
TM helix 3 77..99 CDD:381740 3/21 (14%)
TM helix 4 122..138 CDD:381740 3/15 (20%)
TM helix 5 164..188 CDD:381740 6/23 (26%)
TM helix 6 217..242 CDD:381740 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.