DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Cx3cr1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_598218.1 Gene:Cx3cr1 / 171056 RGDID:620137 Length:354 Species:Rattus norvegicus


Alignment Length:367 Identity:99/367 - (26%)
Similarity:177/367 - (48%) Gaps:62/367 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DSMEYD--AESVALERIVS--TI-VPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLA 117
            ::.|||  ||:..|..||:  || :.:|:.::...||:||.||:|.:..:::.:|.|::.::|||
  Rat    11 ENFEYDDSAEACYLGDIVAFGTIFLSIFYSLVFTFGLVGNLLVVLALTNSRKSKSITDIYLLNLA 75

  Fly   118 VSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTS 182
            :||:|||. .:||. |.|::......|..||.......:.....::.:.::|.||:||:|....|
  Rat    76 LSDLLFVA-TLPFW-THYLISHEGLHNAMCKLTTAFFFIGFFGGIFFITVISIDRYLAIVLAANS 138

  Fly   183 MSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEE---EIWSLV-GFQ 243
            |:.||.::.....:..|...:..|.|.        :.:.......|:....|   |||.:: ..:
  Rat   139 MNNRTVQHGVTISLGVWAAAILVASPQ--------FMFTKRKDNECLGDYPEVLQEIWPVLRNSE 195

  Fly   244 VSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIH 308
            |:  :..:|.||.::.|.|..::..|:        |.::|| |.|..|::::||:.|.:.|.|.:
  Rat   196 VN--ILGFVLPLLIMSFCYFRIVRTLF--------SCKNRK-KARAIRLILLVVVVFFLFWTPYN 249

  Fly   309 VILVLKALNLYG-----GSH------LSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKV- 361
            :::.|:.|..|.     |..      |||     :..||:::.|:||.:|||..:.||:..|.: 
  Rat   250 IVIFLETLKFYNFFPSCGMKRDLRWALSV-----TETVAFSHCCLNPFIYAFAGEKFRRYLRHLY 309

  Fly   362 -----VWCGSP--PPLMTNQQVTK--------TTRTATGNGT 388
                 |.||.|  ....|..|.::        |..|:.|.|:
  Rat   310 NKCLAVLCGRPVHAGFSTESQRSRQDSILSSLTHYTSEGEGS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 42/159 (26%)
7tm_1 91..347 CDD:278431 70/270 (26%)
Cx3cr1NP_598218.1 7tm_1 49..294 CDD:278431 70/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.