DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Ltb4r1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_032545.1 Gene:Ltb4r1 / 16995 MGIID:1309472 Length:351 Species:Mus musculus


Alignment Length:324 Identity:85/324 - (26%)
Similarity:149/324 - (45%) Gaps:37/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TIVPVFFGIIGFA-GLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLP 138
            :::|:....:..| ||.||..|:..::...|.|:.|.||::|||::| |.|:...||........
Mouse    20 SLLPIVLLSVALAVGLPGNSFVVWSILKRMQKRTVTALLVLNLALAD-LAVLLTAPFFLHFLARG 83

  Fly   139 EWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIV 203
            .|.|..:.|:...|:..::.:.||..:.:||.||.|||..|..|..:||:..|...:...|:...
Mouse    84 TWSFREMGCRLCHYVCGISMYASVLLITIMSLDRSLAVARPFMSQKVRTKAFARWVLAGIWVVSF 148

  Fly   204 TTAIPVALSHSVRIYQYHGNAGTACV---FSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGM 265
            ..||||.:..:|:    ..|....|.   .:.|.:::.|: |:.   ::.::.|...:...|..:
Mouse   149 LLAIPVLVYRTVK----WNNRTLICAPNYPNKEHKVFHLL-FEA---ITGFLLPFLAVVASYSDI 205

  Fly   266 LARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKA--------LNLYGGS 322
            ..||         .|...:..||..|:||:::||||..|||.|::.:::|        .|...|.
Mouse   206 GRRL---------QARRFRRSRRTGRLVVLIILAFAAFWLPYHLVNLVEAGRTVAGWDKNSPAGQ 261

  Fly   323 HLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSPPPLM--TNQQVTKTTRTAT 384
            .|. :.:.:...:|:.:|.:||:|||.......::    ...|....|:  |..:|:.|.|..|
Mouse   262 RLR-LARYVLIALAFLSSSVNPVLYACAGGGLLRS----AGVGFVVKLLEGTGSEVSSTRRGGT 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 46/160 (29%)
7tm_1 91..347 CDD:278431 71/266 (27%)
Ltb4r1NP_032545.1 7tm_1 37..285 CDD:278431 71/266 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..351 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.