DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and CX3CR1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001164645.1 Gene:CX3CR1 / 1524 HGNCID:2558 Length:387 Species:Homo sapiens


Alignment Length:375 Identity:95/375 - (25%)
Similarity:175/375 - (46%) Gaps:64/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ATLISSWPKASWGATGNGSIISVSNSSGNNYAFTSEHTDHSDHNANDSMEYD--AESVALERIV- 73
            ::|.|.|..||.                   |||   .|....:..::.|||  ||:..:..|| 
Human    18 SSLASGWRMASG-------------------AFT---MDQFPESVTENFEYDDLAEACYIGDIVV 60

  Fly    74 --STIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYV 136
              :..:.:|:.:|...||:||.||:..:..:::.:|.|::.::|||:||:|||. .:||. |.|:
Human    61 FGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVA-TLPFW-THYL 123

  Fly   137 LPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWIT 201
            :.|....|..|||......:....|::.:.::|.||:||:|....||:.||.::.....:..|..
Human   124 INEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAA 188

  Fly   202 IVTTAIPVALSHSVRIYQYHGNAGTACVFSTEE---EIWSLVGFQVSFFLSSYVAPLTLICFLYM 263
            .:..|.|.        :.:.......|:....|   |||.::....:.|| .::.||.::.:.|.
Human   189 AILVAAPQ--------FMFTKQKENECLGDYPEVLQEIWPVLRNVETNFL-GFLLPLLIMSYCYF 244

  Fly   264 GMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYG-------G 321
            .::..|:    .||     ...|.:..:::::||:.|.:.|.|.:|::.|:.|.||.       .
Human   245 RIIQTLF----SCK-----NHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMR 300

  Fly   322 SHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKV------VWCG 365
            ..|.:.:. ::..||:::.|:||::|||..:.||:....:      |.||
Human   301 KDLRLALS-VTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 45/159 (28%)
7tm_1 91..347 CDD:278431 67/265 (25%)
CX3CR1NP_001164645.1 7tm_1 80..325 CDD:278431 67/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.