DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Cxcr2

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_034039.1 Gene:Cxcr2 / 12765 MGIID:105303 Length:359 Species:Mus musculus


Alignment Length:363 Identity:97/363 - (26%)
Similarity:162/363 - (44%) Gaps:78/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDIL 122
            |::...:|::   .|.|..|.|.:.::....|:||.||:||::.|:...|.|::.::|||::|:.
Mouse    34 DAVPCHSENL---EINSYAVVVIYVLVTLLSLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLF 95

  Fly   123 FVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRT 187
            |.: .:|..|...| ..|.||:..||...|:..||.:.||..|..:|.||:||:|| .||..::.
Mouse    96 FAL-TLPVWAASKV-NGWTFGSTLCKIFSYVKEVTFYSSVLLLACISMDRYLAIVH-ATSTLIQK 157

  Fly   188 ERNATLAIMCAWITIVTTAIPV-ALSHSVRI-------YQYHGNAGTACVFSTEEEIWSLVGFQV 244
            ........:..|:..|..|:|: .|.:.|::       |:..|| .|:.:......:....||.|
Mouse   158 RHLVKFVCIAMWLLSVILALPILILRNPVKVNLSTLVCYEDVGN-NTSRLRVVLRILPQTFGFLV 221

  Fly   245 SFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHV 309
                     ||.::.|.|...|..|:|:..|         .|.|..|::..|||.|.:||||.::
Mouse   222 ---------PLLIMLFCYGFTLRTLFKAHMG---------QKHRAMRVIFAVVLVFLLCWLPYNL 268

  Fly   310 IL--------------------VLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNF 354
            :|                    :.||||             .:.::.:.:||:|||:|||:...|
Mouse   269 VLFTDTLMRTKLIKETCERRDDIDKALN-------------ATEILGFLHSCLNPIIYAFIGQKF 320

  Fly   355 RKAFRKVVWC------------GSPPPLMTNQQVTKTT 380
            |....|::..            |.|..:.::...|.||
Mouse   321 RHGLLKIMATYGLVSKEFLAKEGRPSFVSSSSANTSTT 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 48/164 (29%)
7tm_1 91..347 CDD:278431 79/283 (28%)
Cxcr2NP_034039.1 7tmA_CXCR1_2 48..324 CDD:341333 87/310 (28%)
TM helix 1 48..75 CDD:341333 9/26 (35%)
TM helix 2 82..107 CDD:341333 8/25 (32%)
TM helix 3 118..148 CDD:341333 13/29 (45%)
TM helix 4 159..181 CDD:341333 4/21 (19%)
TM helix 5 207..235 CDD:341333 7/36 (19%)
TM helix 6 243..273 CDD:341333 13/38 (34%)
TM helix 7 292..317 CDD:341333 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.