DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and Cysltr1

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_446093.1 Gene:Cysltr1 / 114099 RGDID:619796 Length:339 Species:Rattus norvegicus


Alignment Length:340 Identity:93/340 - (27%)
Similarity:160/340 - (47%) Gaps:58/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTT 109
            |:..:::..|:..|...        .::.||:    :.:|...|..||..|:.|::.....:|..
  Rat     8 TASFSNNRCHDTIDEFR--------NQVYSTM----YSMISVVGFFGNSFVLYVLIKTYHEKSAF 60

  Fly   110 NLLIINLAVSDILFVIFC-VPFTATDYV-LPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDR 172
            .:.:||||::|:|.|  | :|.....|| ..:|.||:..|:...|.:.|..:||::.:..|||.|
  Rat    61 QVYMINLAIADLLCV--CTLPLRVVYYVHKGKWFFGDFLCRLTTYALYVNLYCSIFFMTAMSFFR 123

  Fly   173 FLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEE--- 234
            .:|:|.||.:::|.|::.|....:..||.::.|:.|..||.|   ||...| .|.|....::   
  Rat   124 CVAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLLSKS---YQDEKN-NTKCFEPPQDKQT 184

  Fly   235 EIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKRRVTRMVVVVVLA 299
            :.:.||...|| .:..::.|...|...|..::..|.|:.  .|.:..||   |:...|::||..|
  Rat   185 KKYVLVLHYVS-LIFGFIIPFVTIIVCYTMIILTLLKNT--MKKNLPSR---RKAIGMIIVVTAA 243

  Fly   300 FAICWLPIHVILVLKALNLYGGSHL----------------SVIIQIISHVVAYTNSCINPILYA 348
            |.:.::|.|   :.:|::|    |.                ||:|.:   .:|.:|.|.:|:||.
  Rat   244 FLVSFMPYH---IQRAIHL----HFLHSETRSCDSVLRMQKSVVITL---SLAASNCCFDPLLYF 298

  Fly   349 FLSDNFRK---AFRK 360
            |...|||:   .|||
  Rat   299 FSGGNFRRRLSTFRK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 49/161 (30%)
7tm_1 91..347 CDD:278431 77/276 (28%)
Cysltr1NP_446093.1 7tm_4 35..251 CDD:304433 67/227 (30%)
7tm_1 42..297 CDD:278431 77/276 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.