DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R1 and PTGDR2

DIOPT Version :9

Sequence 1:NP_524700.1 Gene:AstA-R1 / 44126 FlyBaseID:FBgn0266429 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_004769.2 Gene:PTGDR2 / 11251 HGNCID:4502 Length:395 Species:Homo sapiens


Alignment Length:336 Identity:89/336 - (26%)
Similarity:137/336 - (40%) Gaps:55/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EHTDHSDHNANDSMEY-DAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTN 110
            |.......::|.|:.| |..:|.|.           |:....||:.|| |||.||..:..::...
Human    15 EQMSRLQSHSNTSIRYIDHAAVLLH-----------GLASLLGLVENG-VILFVVGCRMRQTVVT 67

  Fly   111 LLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLA 175
            ..:::||:||:|.......||....|...|..|..:||....:..:....|.:.|..:|.||.|.
Human    68 TWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGFLLSAISLDRCLQ 132

  Fly   176 VVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSV------RIYQYHG----NAG---TA 227
            ||.||.:.:.||...|....:..|...|...:|..:....      ||..|:.    |.|   .|
Human   133 VVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRIMCYYNVLLLNPGPDRDA 197

  Fly   228 CVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLWKSAPGCKPSAESRKGKR---RV 289
            ...|.:      |...||.||.:::.||.:|...:..:..||            ..:|:|   |.
Human   198 TCNSRQ------VALAVSKFLLAFLVPLAIIASSHAAVSLRL------------QHRGRRRPGRF 244

  Fly   290 TRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQ-----IISHVVAYTNSCINPILYAF 349
            .|:|..||.|||:||.|.||..:|:| ..:....|..::.     :.|  :|:.||..||:||..
Human   245 VRLVAAVVAAFALCWGPYHVFSLLEA-RAHANPGLRPLVWRGLPFVTS--LAFFNSVANPVLYVL 306

  Fly   350 LSDNFRKAFRK 360
            ...:..:..|:
Human   307 TCPDMLRKLRR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R1NP_524700.1 7tm_4 83..>240 CDD:304433 44/169 (26%)
7tm_1 91..347 CDD:278431 76/276 (28%)
PTGDR2NP_004769.2 7tm_1 49..304 CDD:278431 76/276 (28%)
Involved in the recycling of CRTH2 330..333
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.